annotate include/SDL_opengl.h @ 4105:84882a89ca50 SDL-1.2

Date: Thu, 27 Dec 2007 07:38:25 +0000 From: John Bartholomew Subject: [SDL] SDL Semaphore implementation broken on Windows? Hi, Over the past couple of days, I've been battling with SDL, SDL_Mixer and SMPEG to try to find an audio hang bug. I believe I've found the problem, which I think is a race condition inside SDL's semaphore implementation (at least the Windows implementation). The semaphore code uses Windows' built in semaphore functions, but it also maintains a separate count value. This count value is updated with bare increment and decrement operations in SemPost and SemWaitTimeout - no locking primitives to protect them. In tracking down the apparent audio bug, I found that at some point a semaphore's count value was being decremented to -1, which is clearly not a valid value for it to take. I'm still not certain exactly what sequence of operations is occuring for this to happen, but I believe that overall it's a race condition between a thread calling SemPost (which increments the count) and the thread on the other end calling SemWait (which decrements it). I will try to make a test case to verify this, but I'm not sure if I'll be able to (threading errors being difficult to reproduce even in the best circumstances). However, assuming this is the cause of my problems, there is a very simple fix: Windows provides InterlockedIncrement() and InterlockedDecrement() functions to perform increments and decrements which are guaranteed to be atomic. So the fix is in thread/win32/SDL_syssem.c: replace occurrences of --sem->count with InterlockedDecrement(&sem->count); and replace occurrences of ++sem->count with InterlockedIncrement(&sem->count); This is using SDL v1.2.12, built with VC++ 2008 Express, running on a Core 2 duo processor.
author Sam Lantinga <slouken@libsdl.org>
date Fri, 28 Dec 2007 22:05:17 +0000
parents e79e4c5e531b
children 782fd950bd46 c121d94672cb a1b03ba2fcd0
rev   line source
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1 /*
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
2 SDL - Simple DirectMedia Layer
1312
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
3 Copyright (C) 1997-2006 Sam Lantinga
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
4
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
5 This library is free software; you can redistribute it and/or
1312
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
6 modify it under the terms of the GNU Lesser General Public
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
7 License as published by the Free Software Foundation; either
1312
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
8 version 2.1 of the License, or (at your option) any later version.
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
9
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
10 This library is distributed in the hope that it will be useful,
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
11 but WITHOUT ANY WARRANTY; without even the implied warranty of
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
12 MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
1312
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
13 Lesser General Public License for more details.
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
14
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
15 You should have received a copy of the GNU Lesser General Public
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
16 License along with this library; if not, write to the Free Software
c9b51268668f Updated copyright information and removed rcs id lines (problematic in branch merges)
Sam Lantinga <slouken@libsdl.org>
parents: 1205
diff changeset
17 Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
18
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
19 Sam Lantinga
251
b8688cfdc232 Updated the headers with the correct e-mail address
Sam Lantinga <slouken@libsdl.org>
parents: 242
diff changeset
20 slouken@libsdl.org
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
21 */
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
22
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
23 /* This is a simple file to encapsulate the OpenGL API headers */
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
24
1402
d910939febfa Use consistent identifiers for the various platforms we support.
Sam Lantinga <slouken@libsdl.org>
parents: 1312
diff changeset
25 #include "SDL_config.h"
d910939febfa Use consistent identifiers for the various platforms we support.
Sam Lantinga <slouken@libsdl.org>
parents: 1312
diff changeset
26
d910939febfa Use consistent identifiers for the various platforms we support.
Sam Lantinga <slouken@libsdl.org>
parents: 1312
diff changeset
27 #ifdef __WIN32__
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
28 #define WIN32_LEAN_AND_MEAN
725
9ee05fe728df *** empty log message ***
Sam Lantinga <slouken@libsdl.org>
parents: 600
diff changeset
29 #ifndef NOMINMAX
600
e5f3ff1580f3 *** empty log message ***
Sam Lantinga <slouken@libsdl.org>
parents: 312
diff changeset
30 #define NOMINMAX /* Don't defined min() and max() */
725
9ee05fe728df *** empty log message ***
Sam Lantinga <slouken@libsdl.org>
parents: 600
diff changeset
31 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
32 #include <windows.h>
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
33 #endif
932
66761191fc11 Use the canonical glext.h on MacOS X as well (#define NO_SDL_GLEXT if you don't want this)
Sam Lantinga <slouken@libsdl.org>
parents: 843
diff changeset
34 #ifndef NO_SDL_GLEXT
66761191fc11 Use the canonical glext.h on MacOS X as well (#define NO_SDL_GLEXT if you don't want this)
Sam Lantinga <slouken@libsdl.org>
parents: 843
diff changeset
35 #define __glext_h_ /* Don't let gl.h include glext.h */
66761191fc11 Use the canonical glext.h on MacOS X as well (#define NO_SDL_GLEXT if you don't want this)
Sam Lantinga <slouken@libsdl.org>
parents: 843
diff changeset
36 #endif
1424
7a610f25c12f Updated MacOS Classic MPW build
Sam Lantinga <slouken@libsdl.org>
parents: 1402
diff changeset
37 #if defined(__MACOSX__)
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
38 #include <OpenGL/gl.h> /* Header File For The OpenGL Library */
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
39 #include <OpenGL/glu.h> /* Header File For The GLU Library */
1619
e79e4c5e531b From Anders F Bjorklund:
Sam Lantinga <slouken@libsdl.org>
parents: 1430
diff changeset
40 #elif defined(__MACOS__)
e79e4c5e531b From Anders F Bjorklund:
Sam Lantinga <slouken@libsdl.org>
parents: 1430
diff changeset
41 #include <gl.h> /* Header File For The OpenGL Library */
e79e4c5e531b From Anders F Bjorklund:
Sam Lantinga <slouken@libsdl.org>
parents: 1430
diff changeset
42 #include <glu.h> /* Header File For The GLU Library */
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
43 #else
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
44 #include <GL/gl.h> /* Header File For The OpenGL Library */
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
45 #include <GL/glu.h> /* Header File For The GLU Library */
932
66761191fc11 Use the canonical glext.h on MacOS X as well (#define NO_SDL_GLEXT if you don't want this)
Sam Lantinga <slouken@libsdl.org>
parents: 843
diff changeset
46 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
47 #ifndef NO_SDL_GLEXT
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
48 #undef __glext_h_
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
49 #endif
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
50
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
51 /* This file taken from "GLext.h" from the Jeff Molofee OpenGL tutorials.
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
52 It is included here because glext.h is not available on some systems.
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
53 If you don't want this version included, simply define "NO_SDL_GLEXT"
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
54 */
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
55 #ifndef NO_SDL_GLEXT
242
4bcb29d3769c Added support for Xi Graphics XME fullscreen extension
Sam Lantinga <slouken@libsdl.org>
parents: 214
diff changeset
56 #if !defined(__glext_h_) && !defined(GL_GLEXT_LEGACY)
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
57 #define __glext_h_
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
58
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
59 #ifdef __cplusplus
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
60 extern "C" {
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
61 #endif
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
62
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
63 /*
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
64 ** License Applicability. Except to the extent portions of this file are
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
65 ** made subject to an alternative license as permitted in the SGI Free
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
66 ** Software License B, Version 1.1 (the "License"), the contents of this
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
67 ** file are subject only to the provisions of the License. You may not use
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
68 ** this file except in compliance with the License. You may obtain a copy
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
69 ** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
70 ** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
71 **
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
72 ** http://oss.sgi.com/projects/FreeB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
73 **
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
74 ** Note that, as provided in the License, the Software is distributed on an
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
75 ** "AS IS" basis, with ALL EXPRESS AND IMPLIED WARRANTIES AND CONDITIONS
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
76 ** DISCLAIMED, INCLUDING, WITHOUT LIMITATION, ANY IMPLIED WARRANTIES AND
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
77 ** CONDITIONS OF MERCHANTABILITY, SATISFACTORY QUALITY, FITNESS FOR A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
78 ** PARTICULAR PURPOSE, AND NON-INFRINGEMENT.
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
79 **
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
80 ** Original Code. The Original Code is: OpenGL Sample Implementation,
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
81 ** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
82 ** Inc. The Original Code is Copyright (c) 1991-2004 Silicon Graphics, Inc.
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
83 ** Copyright in any portions created by third parties is as indicated
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
84 ** elsewhere herein. All Rights Reserved.
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
85 **
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
86 ** Additional Notice Provisions: This software was created using the
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
87 ** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
88 ** not been independently verified as being compliant with the OpenGL(R)
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
89 ** version 1.2.1 Specification.
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
90 */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
91
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
92 #if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
93 #define WIN32_LEAN_AND_MEAN 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
94 #include <windows.h>
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
95 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
96
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
97 #ifndef APIENTRY
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
98 #define APIENTRY
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
99 #endif
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
100 #ifndef APIENTRYP
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
101 #define APIENTRYP APIENTRY *
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
102 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
103 #ifndef GLAPI
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
104 #define GLAPI extern
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
105 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
106
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
107 /*************************************************************/
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
108
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
109 /* Header file version number, required by OpenGL ABI for Linux */
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
110 /* glext.h last updated 2005/06/20 */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
111 /* Current version at http://oss.sgi.com/projects/ogl-sample/registry/ */
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
112 #define GL_GLEXT_VERSION 29
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
113
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
114 #ifndef GL_VERSION_1_2
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
115 #define GL_UNSIGNED_BYTE_3_3_2 0x8032
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
116 #define GL_UNSIGNED_SHORT_4_4_4_4 0x8033
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
117 #define GL_UNSIGNED_SHORT_5_5_5_1 0x8034
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
118 #define GL_UNSIGNED_INT_8_8_8_8 0x8035
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
119 #define GL_UNSIGNED_INT_10_10_10_2 0x8036
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
120 #define GL_RESCALE_NORMAL 0x803A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
121 #define GL_TEXTURE_BINDING_3D 0x806A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
122 #define GL_PACK_SKIP_IMAGES 0x806B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
123 #define GL_PACK_IMAGE_HEIGHT 0x806C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
124 #define GL_UNPACK_SKIP_IMAGES 0x806D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
125 #define GL_UNPACK_IMAGE_HEIGHT 0x806E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
126 #define GL_TEXTURE_3D 0x806F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
127 #define GL_PROXY_TEXTURE_3D 0x8070
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
128 #define GL_TEXTURE_DEPTH 0x8071
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
129 #define GL_TEXTURE_WRAP_R 0x8072
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
130 #define GL_MAX_3D_TEXTURE_SIZE 0x8073
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
131 #define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
132 #define GL_UNSIGNED_SHORT_5_6_5 0x8363
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
133 #define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
134 #define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
135 #define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
136 #define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
137 #define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
138 #define GL_BGR 0x80E0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
139 #define GL_BGRA 0x80E1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
140 #define GL_MAX_ELEMENTS_VERTICES 0x80E8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
141 #define GL_MAX_ELEMENTS_INDICES 0x80E9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
142 #define GL_CLAMP_TO_EDGE 0x812F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
143 #define GL_TEXTURE_MIN_LOD 0x813A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
144 #define GL_TEXTURE_MAX_LOD 0x813B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
145 #define GL_TEXTURE_BASE_LEVEL 0x813C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
146 #define GL_TEXTURE_MAX_LEVEL 0x813D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
147 #define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
148 #define GL_SINGLE_COLOR 0x81F9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
149 #define GL_SEPARATE_SPECULAR_COLOR 0x81FA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
150 #define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
151 #define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
152 #define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
153 #define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
154 #define GL_ALIASED_POINT_SIZE_RANGE 0x846D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
155 #define GL_ALIASED_LINE_WIDTH_RANGE 0x846E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
156 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
157
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
158 #ifndef GL_ARB_imaging
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
159 #define GL_CONSTANT_COLOR 0x8001
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
160 #define GL_ONE_MINUS_CONSTANT_COLOR 0x8002
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
161 #define GL_CONSTANT_ALPHA 0x8003
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
162 #define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
163 #define GL_BLEND_COLOR 0x8005
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
164 #define GL_FUNC_ADD 0x8006
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
165 #define GL_MIN 0x8007
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
166 #define GL_MAX 0x8008
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
167 #define GL_BLEND_EQUATION 0x8009
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
168 #define GL_FUNC_SUBTRACT 0x800A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
169 #define GL_FUNC_REVERSE_SUBTRACT 0x800B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
170 #define GL_CONVOLUTION_1D 0x8010
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
171 #define GL_CONVOLUTION_2D 0x8011
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
172 #define GL_SEPARABLE_2D 0x8012
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
173 #define GL_CONVOLUTION_BORDER_MODE 0x8013
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
174 #define GL_CONVOLUTION_FILTER_SCALE 0x8014
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
175 #define GL_CONVOLUTION_FILTER_BIAS 0x8015
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
176 #define GL_REDUCE 0x8016
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
177 #define GL_CONVOLUTION_FORMAT 0x8017
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
178 #define GL_CONVOLUTION_WIDTH 0x8018
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
179 #define GL_CONVOLUTION_HEIGHT 0x8019
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
180 #define GL_MAX_CONVOLUTION_WIDTH 0x801A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
181 #define GL_MAX_CONVOLUTION_HEIGHT 0x801B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
182 #define GL_POST_CONVOLUTION_RED_SCALE 0x801C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
183 #define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
184 #define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
185 #define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
186 #define GL_POST_CONVOLUTION_RED_BIAS 0x8020
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
187 #define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
188 #define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
189 #define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
190 #define GL_HISTOGRAM 0x8024
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
191 #define GL_PROXY_HISTOGRAM 0x8025
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
192 #define GL_HISTOGRAM_WIDTH 0x8026
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
193 #define GL_HISTOGRAM_FORMAT 0x8027
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
194 #define GL_HISTOGRAM_RED_SIZE 0x8028
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
195 #define GL_HISTOGRAM_GREEN_SIZE 0x8029
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
196 #define GL_HISTOGRAM_BLUE_SIZE 0x802A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
197 #define GL_HISTOGRAM_ALPHA_SIZE 0x802B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
198 #define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
199 #define GL_HISTOGRAM_SINK 0x802D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
200 #define GL_MINMAX 0x802E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
201 #define GL_MINMAX_FORMAT 0x802F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
202 #define GL_MINMAX_SINK 0x8030
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
203 #define GL_TABLE_TOO_LARGE 0x8031
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
204 #define GL_COLOR_MATRIX 0x80B1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
205 #define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
206 #define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
207 #define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
208 #define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
209 #define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
210 #define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
211 #define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
212 #define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
213 #define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
214 #define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
215 #define GL_COLOR_TABLE 0x80D0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
216 #define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
217 #define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
218 #define GL_PROXY_COLOR_TABLE 0x80D3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
219 #define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
220 #define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
221 #define GL_COLOR_TABLE_SCALE 0x80D6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
222 #define GL_COLOR_TABLE_BIAS 0x80D7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
223 #define GL_COLOR_TABLE_FORMAT 0x80D8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
224 #define GL_COLOR_TABLE_WIDTH 0x80D9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
225 #define GL_COLOR_TABLE_RED_SIZE 0x80DA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
226 #define GL_COLOR_TABLE_GREEN_SIZE 0x80DB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
227 #define GL_COLOR_TABLE_BLUE_SIZE 0x80DC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
228 #define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
229 #define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
230 #define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
231 #define GL_CONSTANT_BORDER 0x8151
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
232 #define GL_REPLICATE_BORDER 0x8153
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
233 #define GL_CONVOLUTION_BORDER_COLOR 0x8154
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
234 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
235
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
236 #ifndef GL_VERSION_1_3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
237 #define GL_TEXTURE0 0x84C0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
238 #define GL_TEXTURE1 0x84C1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
239 #define GL_TEXTURE2 0x84C2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
240 #define GL_TEXTURE3 0x84C3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
241 #define GL_TEXTURE4 0x84C4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
242 #define GL_TEXTURE5 0x84C5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
243 #define GL_TEXTURE6 0x84C6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
244 #define GL_TEXTURE7 0x84C7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
245 #define GL_TEXTURE8 0x84C8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
246 #define GL_TEXTURE9 0x84C9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
247 #define GL_TEXTURE10 0x84CA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
248 #define GL_TEXTURE11 0x84CB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
249 #define GL_TEXTURE12 0x84CC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
250 #define GL_TEXTURE13 0x84CD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
251 #define GL_TEXTURE14 0x84CE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
252 #define GL_TEXTURE15 0x84CF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
253 #define GL_TEXTURE16 0x84D0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
254 #define GL_TEXTURE17 0x84D1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
255 #define GL_TEXTURE18 0x84D2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
256 #define GL_TEXTURE19 0x84D3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
257 #define GL_TEXTURE20 0x84D4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
258 #define GL_TEXTURE21 0x84D5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
259 #define GL_TEXTURE22 0x84D6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
260 #define GL_TEXTURE23 0x84D7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
261 #define GL_TEXTURE24 0x84D8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
262 #define GL_TEXTURE25 0x84D9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
263 #define GL_TEXTURE26 0x84DA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
264 #define GL_TEXTURE27 0x84DB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
265 #define GL_TEXTURE28 0x84DC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
266 #define GL_TEXTURE29 0x84DD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
267 #define GL_TEXTURE30 0x84DE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
268 #define GL_TEXTURE31 0x84DF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
269 #define GL_ACTIVE_TEXTURE 0x84E0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
270 #define GL_CLIENT_ACTIVE_TEXTURE 0x84E1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
271 #define GL_MAX_TEXTURE_UNITS 0x84E2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
272 #define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
273 #define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
274 #define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
275 #define GL_TRANSPOSE_COLOR_MATRIX 0x84E6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
276 #define GL_MULTISAMPLE 0x809D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
277 #define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
278 #define GL_SAMPLE_ALPHA_TO_ONE 0x809F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
279 #define GL_SAMPLE_COVERAGE 0x80A0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
280 #define GL_SAMPLE_BUFFERS 0x80A8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
281 #define GL_SAMPLES 0x80A9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
282 #define GL_SAMPLE_COVERAGE_VALUE 0x80AA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
283 #define GL_SAMPLE_COVERAGE_INVERT 0x80AB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
284 #define GL_MULTISAMPLE_BIT 0x20000000
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
285 #define GL_NORMAL_MAP 0x8511
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
286 #define GL_REFLECTION_MAP 0x8512
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
287 #define GL_TEXTURE_CUBE_MAP 0x8513
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
288 #define GL_TEXTURE_BINDING_CUBE_MAP 0x8514
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
289 #define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
290 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
291 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
292 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
293 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
294 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
295 #define GL_PROXY_TEXTURE_CUBE_MAP 0x851B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
296 #define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
297 #define GL_COMPRESSED_ALPHA 0x84E9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
298 #define GL_COMPRESSED_LUMINANCE 0x84EA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
299 #define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
300 #define GL_COMPRESSED_INTENSITY 0x84EC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
301 #define GL_COMPRESSED_RGB 0x84ED
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
302 #define GL_COMPRESSED_RGBA 0x84EE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
303 #define GL_TEXTURE_COMPRESSION_HINT 0x84EF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
304 #define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
305 #define GL_TEXTURE_COMPRESSED 0x86A1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
306 #define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
307 #define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
308 #define GL_CLAMP_TO_BORDER 0x812D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
309 #define GL_COMBINE 0x8570
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
310 #define GL_COMBINE_RGB 0x8571
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
311 #define GL_COMBINE_ALPHA 0x8572
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
312 #define GL_SOURCE0_RGB 0x8580
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
313 #define GL_SOURCE1_RGB 0x8581
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
314 #define GL_SOURCE2_RGB 0x8582
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
315 #define GL_SOURCE0_ALPHA 0x8588
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
316 #define GL_SOURCE1_ALPHA 0x8589
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
317 #define GL_SOURCE2_ALPHA 0x858A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
318 #define GL_OPERAND0_RGB 0x8590
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
319 #define GL_OPERAND1_RGB 0x8591
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
320 #define GL_OPERAND2_RGB 0x8592
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
321 #define GL_OPERAND0_ALPHA 0x8598
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
322 #define GL_OPERAND1_ALPHA 0x8599
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
323 #define GL_OPERAND2_ALPHA 0x859A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
324 #define GL_RGB_SCALE 0x8573
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
325 #define GL_ADD_SIGNED 0x8574
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
326 #define GL_INTERPOLATE 0x8575
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
327 #define GL_SUBTRACT 0x84E7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
328 #define GL_CONSTANT 0x8576
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
329 #define GL_PRIMARY_COLOR 0x8577
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
330 #define GL_PREVIOUS 0x8578
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
331 #define GL_DOT3_RGB 0x86AE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
332 #define GL_DOT3_RGBA 0x86AF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
333 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
334
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
335 #ifndef GL_VERSION_1_4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
336 #define GL_BLEND_DST_RGB 0x80C8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
337 #define GL_BLEND_SRC_RGB 0x80C9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
338 #define GL_BLEND_DST_ALPHA 0x80CA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
339 #define GL_BLEND_SRC_ALPHA 0x80CB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
340 #define GL_POINT_SIZE_MIN 0x8126
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
341 #define GL_POINT_SIZE_MAX 0x8127
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
342 #define GL_POINT_FADE_THRESHOLD_SIZE 0x8128
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
343 #define GL_POINT_DISTANCE_ATTENUATION 0x8129
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
344 #define GL_GENERATE_MIPMAP 0x8191
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
345 #define GL_GENERATE_MIPMAP_HINT 0x8192
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
346 #define GL_DEPTH_COMPONENT16 0x81A5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
347 #define GL_DEPTH_COMPONENT24 0x81A6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
348 #define GL_DEPTH_COMPONENT32 0x81A7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
349 #define GL_MIRRORED_REPEAT 0x8370
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
350 #define GL_FOG_COORDINATE_SOURCE 0x8450
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
351 #define GL_FOG_COORDINATE 0x8451
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
352 #define GL_FRAGMENT_DEPTH 0x8452
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
353 #define GL_CURRENT_FOG_COORDINATE 0x8453
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
354 #define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
355 #define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
356 #define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
357 #define GL_FOG_COORDINATE_ARRAY 0x8457
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
358 #define GL_COLOR_SUM 0x8458
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
359 #define GL_CURRENT_SECONDARY_COLOR 0x8459
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
360 #define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
361 #define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
362 #define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
363 #define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
364 #define GL_SECONDARY_COLOR_ARRAY 0x845E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
365 #define GL_MAX_TEXTURE_LOD_BIAS 0x84FD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
366 #define GL_TEXTURE_FILTER_CONTROL 0x8500
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
367 #define GL_TEXTURE_LOD_BIAS 0x8501
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
368 #define GL_INCR_WRAP 0x8507
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
369 #define GL_DECR_WRAP 0x8508
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
370 #define GL_TEXTURE_DEPTH_SIZE 0x884A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
371 #define GL_DEPTH_TEXTURE_MODE 0x884B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
372 #define GL_TEXTURE_COMPARE_MODE 0x884C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
373 #define GL_TEXTURE_COMPARE_FUNC 0x884D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
374 #define GL_COMPARE_R_TO_TEXTURE 0x884E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
375 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
376
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
377 #ifndef GL_VERSION_1_5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
378 #define GL_BUFFER_SIZE 0x8764
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
379 #define GL_BUFFER_USAGE 0x8765
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
380 #define GL_QUERY_COUNTER_BITS 0x8864
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
381 #define GL_CURRENT_QUERY 0x8865
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
382 #define GL_QUERY_RESULT 0x8866
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
383 #define GL_QUERY_RESULT_AVAILABLE 0x8867
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
384 #define GL_ARRAY_BUFFER 0x8892
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
385 #define GL_ELEMENT_ARRAY_BUFFER 0x8893
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
386 #define GL_ARRAY_BUFFER_BINDING 0x8894
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
387 #define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
388 #define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
389 #define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
390 #define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
391 #define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
392 #define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
393 #define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
394 #define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
395 #define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
396 #define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
397 #define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
398 #define GL_READ_ONLY 0x88B8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
399 #define GL_WRITE_ONLY 0x88B9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
400 #define GL_READ_WRITE 0x88BA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
401 #define GL_BUFFER_ACCESS 0x88BB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
402 #define GL_BUFFER_MAPPED 0x88BC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
403 #define GL_BUFFER_MAP_POINTER 0x88BD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
404 #define GL_STREAM_DRAW 0x88E0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
405 #define GL_STREAM_READ 0x88E1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
406 #define GL_STREAM_COPY 0x88E2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
407 #define GL_STATIC_DRAW 0x88E4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
408 #define GL_STATIC_READ 0x88E5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
409 #define GL_STATIC_COPY 0x88E6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
410 #define GL_DYNAMIC_DRAW 0x88E8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
411 #define GL_DYNAMIC_READ 0x88E9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
412 #define GL_DYNAMIC_COPY 0x88EA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
413 #define GL_SAMPLES_PASSED 0x8914
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
414 #define GL_FOG_COORD_SRC GL_FOG_COORDINATE_SOURCE
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
415 #define GL_FOG_COORD GL_FOG_COORDINATE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
416 #define GL_CURRENT_FOG_COORD GL_CURRENT_FOG_COORDINATE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
417 #define GL_FOG_COORD_ARRAY_TYPE GL_FOG_COORDINATE_ARRAY_TYPE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
418 #define GL_FOG_COORD_ARRAY_STRIDE GL_FOG_COORDINATE_ARRAY_STRIDE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
419 #define GL_FOG_COORD_ARRAY_POINTER GL_FOG_COORDINATE_ARRAY_POINTER
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
420 #define GL_FOG_COORD_ARRAY GL_FOG_COORDINATE_ARRAY
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
421 #define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
422 #define GL_SRC0_RGB GL_SOURCE0_RGB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
423 #define GL_SRC1_RGB GL_SOURCE1_RGB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
424 #define GL_SRC2_RGB GL_SOURCE2_RGB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
425 #define GL_SRC0_ALPHA GL_SOURCE0_ALPHA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
426 #define GL_SRC1_ALPHA GL_SOURCE1_ALPHA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
427 #define GL_SRC2_ALPHA GL_SOURCE2_ALPHA
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
428 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
429
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
430 #ifndef GL_VERSION_2_0
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
431 #define GL_BLEND_EQUATION_RGB GL_BLEND_EQUATION
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
432 #define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
433 #define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
434 #define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
435 #define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
436 #define GL_CURRENT_VERTEX_ATTRIB 0x8626
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
437 #define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
438 #define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
439 #define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
440 #define GL_STENCIL_BACK_FUNC 0x8800
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
441 #define GL_STENCIL_BACK_FAIL 0x8801
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
442 #define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
443 #define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
444 #define GL_MAX_DRAW_BUFFERS 0x8824
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
445 #define GL_DRAW_BUFFER0 0x8825
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
446 #define GL_DRAW_BUFFER1 0x8826
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
447 #define GL_DRAW_BUFFER2 0x8827
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
448 #define GL_DRAW_BUFFER3 0x8828
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
449 #define GL_DRAW_BUFFER4 0x8829
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
450 #define GL_DRAW_BUFFER5 0x882A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
451 #define GL_DRAW_BUFFER6 0x882B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
452 #define GL_DRAW_BUFFER7 0x882C
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
453 #define GL_DRAW_BUFFER8 0x882D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
454 #define GL_DRAW_BUFFER9 0x882E
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
455 #define GL_DRAW_BUFFER10 0x882F
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
456 #define GL_DRAW_BUFFER11 0x8830
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
457 #define GL_DRAW_BUFFER12 0x8831
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
458 #define GL_DRAW_BUFFER13 0x8832
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
459 #define GL_DRAW_BUFFER14 0x8833
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
460 #define GL_DRAW_BUFFER15 0x8834
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
461 #define GL_BLEND_EQUATION_ALPHA 0x883D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
462 #define GL_POINT_SPRITE 0x8861
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
463 #define GL_COORD_REPLACE 0x8862
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
464 #define GL_MAX_VERTEX_ATTRIBS 0x8869
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
465 #define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
466 #define GL_MAX_TEXTURE_COORDS 0x8871
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
467 #define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
468 #define GL_FRAGMENT_SHADER 0x8B30
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
469 #define GL_VERTEX_SHADER 0x8B31
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
470 #define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
471 #define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
472 #define GL_MAX_VARYING_FLOATS 0x8B4B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
473 #define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
474 #define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
475 #define GL_SHADER_TYPE 0x8B4F
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
476 #define GL_FLOAT_VEC2 0x8B50
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
477 #define GL_FLOAT_VEC3 0x8B51
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
478 #define GL_FLOAT_VEC4 0x8B52
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
479 #define GL_INT_VEC2 0x8B53
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
480 #define GL_INT_VEC3 0x8B54
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
481 #define GL_INT_VEC4 0x8B55
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
482 #define GL_BOOL 0x8B56
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
483 #define GL_BOOL_VEC2 0x8B57
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
484 #define GL_BOOL_VEC3 0x8B58
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
485 #define GL_BOOL_VEC4 0x8B59
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
486 #define GL_FLOAT_MAT2 0x8B5A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
487 #define GL_FLOAT_MAT3 0x8B5B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
488 #define GL_FLOAT_MAT4 0x8B5C
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
489 #define GL_SAMPLER_1D 0x8B5D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
490 #define GL_SAMPLER_2D 0x8B5E
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
491 #define GL_SAMPLER_3D 0x8B5F
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
492 #define GL_SAMPLER_CUBE 0x8B60
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
493 #define GL_SAMPLER_1D_SHADOW 0x8B61
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
494 #define GL_SAMPLER_2D_SHADOW 0x8B62
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
495 #define GL_DELETE_STATUS 0x8B80
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
496 #define GL_COMPILE_STATUS 0x8B81
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
497 #define GL_LINK_STATUS 0x8B82
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
498 #define GL_VALIDATE_STATUS 0x8B83
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
499 #define GL_INFO_LOG_LENGTH 0x8B84
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
500 #define GL_ATTACHED_SHADERS 0x8B85
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
501 #define GL_ACTIVE_UNIFORMS 0x8B86
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
502 #define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
503 #define GL_SHADER_SOURCE_LENGTH 0x8B88
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
504 #define GL_ACTIVE_ATTRIBUTES 0x8B89
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
505 #define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
506 #define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
507 #define GL_SHADING_LANGUAGE_VERSION 0x8B8C
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
508 #define GL_CURRENT_PROGRAM 0x8B8D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
509 #define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
510 #define GL_LOWER_LEFT 0x8CA1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
511 #define GL_UPPER_LEFT 0x8CA2
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
512 #define GL_STENCIL_BACK_REF 0x8CA3
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
513 #define GL_STENCIL_BACK_VALUE_MASK 0x8CA4
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
514 #define GL_STENCIL_BACK_WRITEMASK 0x8CA5
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
515 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
516
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
517 #ifndef GL_ARB_multitexture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
518 #define GL_TEXTURE0_ARB 0x84C0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
519 #define GL_TEXTURE1_ARB 0x84C1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
520 #define GL_TEXTURE2_ARB 0x84C2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
521 #define GL_TEXTURE3_ARB 0x84C3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
522 #define GL_TEXTURE4_ARB 0x84C4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
523 #define GL_TEXTURE5_ARB 0x84C5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
524 #define GL_TEXTURE6_ARB 0x84C6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
525 #define GL_TEXTURE7_ARB 0x84C7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
526 #define GL_TEXTURE8_ARB 0x84C8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
527 #define GL_TEXTURE9_ARB 0x84C9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
528 #define GL_TEXTURE10_ARB 0x84CA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
529 #define GL_TEXTURE11_ARB 0x84CB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
530 #define GL_TEXTURE12_ARB 0x84CC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
531 #define GL_TEXTURE13_ARB 0x84CD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
532 #define GL_TEXTURE14_ARB 0x84CE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
533 #define GL_TEXTURE15_ARB 0x84CF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
534 #define GL_TEXTURE16_ARB 0x84D0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
535 #define GL_TEXTURE17_ARB 0x84D1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
536 #define GL_TEXTURE18_ARB 0x84D2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
537 #define GL_TEXTURE19_ARB 0x84D3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
538 #define GL_TEXTURE20_ARB 0x84D4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
539 #define GL_TEXTURE21_ARB 0x84D5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
540 #define GL_TEXTURE22_ARB 0x84D6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
541 #define GL_TEXTURE23_ARB 0x84D7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
542 #define GL_TEXTURE24_ARB 0x84D8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
543 #define GL_TEXTURE25_ARB 0x84D9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
544 #define GL_TEXTURE26_ARB 0x84DA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
545 #define GL_TEXTURE27_ARB 0x84DB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
546 #define GL_TEXTURE28_ARB 0x84DC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
547 #define GL_TEXTURE29_ARB 0x84DD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
548 #define GL_TEXTURE30_ARB 0x84DE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
549 #define GL_TEXTURE31_ARB 0x84DF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
550 #define GL_ACTIVE_TEXTURE_ARB 0x84E0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
551 #define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
552 #define GL_MAX_TEXTURE_UNITS_ARB 0x84E2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
553 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
554
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
555 #ifndef GL_ARB_transpose_matrix
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
556 #define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
557 #define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
558 #define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
559 #define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
560 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
561
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
562 #ifndef GL_ARB_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
563 #define GL_MULTISAMPLE_ARB 0x809D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
564 #define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
565 #define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
566 #define GL_SAMPLE_COVERAGE_ARB 0x80A0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
567 #define GL_SAMPLE_BUFFERS_ARB 0x80A8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
568 #define GL_SAMPLES_ARB 0x80A9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
569 #define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
570 #define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
571 #define GL_MULTISAMPLE_BIT_ARB 0x20000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
572 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
573
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
574 #ifndef GL_ARB_texture_env_add
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
575 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
576
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
577 #ifndef GL_ARB_texture_cube_map
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
578 #define GL_NORMAL_MAP_ARB 0x8511
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
579 #define GL_REFLECTION_MAP_ARB 0x8512
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
580 #define GL_TEXTURE_CUBE_MAP_ARB 0x8513
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
581 #define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
582 #define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
583 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
584 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
585 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
586 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
587 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
588 #define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
589 #define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
590 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
591
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
592 #ifndef GL_ARB_texture_compression
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
593 #define GL_COMPRESSED_ALPHA_ARB 0x84E9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
594 #define GL_COMPRESSED_LUMINANCE_ARB 0x84EA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
595 #define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
596 #define GL_COMPRESSED_INTENSITY_ARB 0x84EC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
597 #define GL_COMPRESSED_RGB_ARB 0x84ED
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
598 #define GL_COMPRESSED_RGBA_ARB 0x84EE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
599 #define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
600 #define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
601 #define GL_TEXTURE_COMPRESSED_ARB 0x86A1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
602 #define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
603 #define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
604 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
605
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
606 #ifndef GL_ARB_texture_border_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
607 #define GL_CLAMP_TO_BORDER_ARB 0x812D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
608 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
609
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
610 #ifndef GL_ARB_point_parameters
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
611 #define GL_POINT_SIZE_MIN_ARB 0x8126
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
612 #define GL_POINT_SIZE_MAX_ARB 0x8127
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
613 #define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
614 #define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
615 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
616
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
617 #ifndef GL_ARB_vertex_blend
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
618 #define GL_MAX_VERTEX_UNITS_ARB 0x86A4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
619 #define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
620 #define GL_WEIGHT_SUM_UNITY_ARB 0x86A6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
621 #define GL_VERTEX_BLEND_ARB 0x86A7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
622 #define GL_CURRENT_WEIGHT_ARB 0x86A8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
623 #define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
624 #define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
625 #define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
626 #define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
627 #define GL_WEIGHT_ARRAY_ARB 0x86AD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
628 #define GL_MODELVIEW0_ARB 0x1700
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
629 #define GL_MODELVIEW1_ARB 0x850A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
630 #define GL_MODELVIEW2_ARB 0x8722
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
631 #define GL_MODELVIEW3_ARB 0x8723
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
632 #define GL_MODELVIEW4_ARB 0x8724
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
633 #define GL_MODELVIEW5_ARB 0x8725
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
634 #define GL_MODELVIEW6_ARB 0x8726
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
635 #define GL_MODELVIEW7_ARB 0x8727
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
636 #define GL_MODELVIEW8_ARB 0x8728
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
637 #define GL_MODELVIEW9_ARB 0x8729
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
638 #define GL_MODELVIEW10_ARB 0x872A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
639 #define GL_MODELVIEW11_ARB 0x872B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
640 #define GL_MODELVIEW12_ARB 0x872C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
641 #define GL_MODELVIEW13_ARB 0x872D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
642 #define GL_MODELVIEW14_ARB 0x872E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
643 #define GL_MODELVIEW15_ARB 0x872F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
644 #define GL_MODELVIEW16_ARB 0x8730
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
645 #define GL_MODELVIEW17_ARB 0x8731
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
646 #define GL_MODELVIEW18_ARB 0x8732
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
647 #define GL_MODELVIEW19_ARB 0x8733
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
648 #define GL_MODELVIEW20_ARB 0x8734
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
649 #define GL_MODELVIEW21_ARB 0x8735
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
650 #define GL_MODELVIEW22_ARB 0x8736
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
651 #define GL_MODELVIEW23_ARB 0x8737
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
652 #define GL_MODELVIEW24_ARB 0x8738
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
653 #define GL_MODELVIEW25_ARB 0x8739
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
654 #define GL_MODELVIEW26_ARB 0x873A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
655 #define GL_MODELVIEW27_ARB 0x873B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
656 #define GL_MODELVIEW28_ARB 0x873C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
657 #define GL_MODELVIEW29_ARB 0x873D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
658 #define GL_MODELVIEW30_ARB 0x873E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
659 #define GL_MODELVIEW31_ARB 0x873F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
660 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
661
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
662 #ifndef GL_ARB_matrix_palette
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
663 #define GL_MATRIX_PALETTE_ARB 0x8840
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
664 #define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
665 #define GL_MAX_PALETTE_MATRICES_ARB 0x8842
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
666 #define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
667 #define GL_MATRIX_INDEX_ARRAY_ARB 0x8844
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
668 #define GL_CURRENT_MATRIX_INDEX_ARB 0x8845
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
669 #define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
670 #define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
671 #define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
672 #define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
673 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
674
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
675 #ifndef GL_ARB_texture_env_combine
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
676 #define GL_COMBINE_ARB 0x8570
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
677 #define GL_COMBINE_RGB_ARB 0x8571
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
678 #define GL_COMBINE_ALPHA_ARB 0x8572
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
679 #define GL_SOURCE0_RGB_ARB 0x8580
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
680 #define GL_SOURCE1_RGB_ARB 0x8581
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
681 #define GL_SOURCE2_RGB_ARB 0x8582
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
682 #define GL_SOURCE0_ALPHA_ARB 0x8588
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
683 #define GL_SOURCE1_ALPHA_ARB 0x8589
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
684 #define GL_SOURCE2_ALPHA_ARB 0x858A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
685 #define GL_OPERAND0_RGB_ARB 0x8590
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
686 #define GL_OPERAND1_RGB_ARB 0x8591
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
687 #define GL_OPERAND2_RGB_ARB 0x8592
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
688 #define GL_OPERAND0_ALPHA_ARB 0x8598
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
689 #define GL_OPERAND1_ALPHA_ARB 0x8599
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
690 #define GL_OPERAND2_ALPHA_ARB 0x859A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
691 #define GL_RGB_SCALE_ARB 0x8573
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
692 #define GL_ADD_SIGNED_ARB 0x8574
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
693 #define GL_INTERPOLATE_ARB 0x8575
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
694 #define GL_SUBTRACT_ARB 0x84E7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
695 #define GL_CONSTANT_ARB 0x8576
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
696 #define GL_PRIMARY_COLOR_ARB 0x8577
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
697 #define GL_PREVIOUS_ARB 0x8578
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
698 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
699
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
700 #ifndef GL_ARB_texture_env_crossbar
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
701 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
702
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
703 #ifndef GL_ARB_texture_env_dot3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
704 #define GL_DOT3_RGB_ARB 0x86AE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
705 #define GL_DOT3_RGBA_ARB 0x86AF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
706 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
707
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
708 #ifndef GL_ARB_texture_mirrored_repeat
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
709 #define GL_MIRRORED_REPEAT_ARB 0x8370
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
710 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
711
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
712 #ifndef GL_ARB_depth_texture
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
713 #define GL_DEPTH_COMPONENT16_ARB 0x81A5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
714 #define GL_DEPTH_COMPONENT24_ARB 0x81A6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
715 #define GL_DEPTH_COMPONENT32_ARB 0x81A7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
716 #define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
717 #define GL_DEPTH_TEXTURE_MODE_ARB 0x884B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
718 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
719
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
720 #ifndef GL_ARB_shadow
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
721 #define GL_TEXTURE_COMPARE_MODE_ARB 0x884C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
722 #define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
723 #define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
724 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
725
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
726 #ifndef GL_ARB_shadow_ambient
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
727 #define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
728 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
729
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
730 #ifndef GL_ARB_window_pos
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
731 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
732
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
733 #ifndef GL_ARB_vertex_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
734 #define GL_COLOR_SUM_ARB 0x8458
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
735 #define GL_VERTEX_PROGRAM_ARB 0x8620
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
736 #define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
737 #define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
738 #define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
739 #define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
740 #define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
741 #define GL_PROGRAM_LENGTH_ARB 0x8627
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
742 #define GL_PROGRAM_STRING_ARB 0x8628
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
743 #define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
744 #define GL_MAX_PROGRAM_MATRICES_ARB 0x862F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
745 #define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
746 #define GL_CURRENT_MATRIX_ARB 0x8641
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
747 #define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
748 #define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
749 #define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
750 #define GL_PROGRAM_ERROR_POSITION_ARB 0x864B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
751 #define GL_PROGRAM_BINDING_ARB 0x8677
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
752 #define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
753 #define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
754 #define GL_PROGRAM_ERROR_STRING_ARB 0x8874
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
755 #define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
756 #define GL_PROGRAM_FORMAT_ARB 0x8876
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
757 #define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
758 #define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
759 #define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
760 #define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
761 #define GL_PROGRAM_TEMPORARIES_ARB 0x88A4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
762 #define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
763 #define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
764 #define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
765 #define GL_PROGRAM_PARAMETERS_ARB 0x88A8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
766 #define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
767 #define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
768 #define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
769 #define GL_PROGRAM_ATTRIBS_ARB 0x88AC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
770 #define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
771 #define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
772 #define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
773 #define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
774 #define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
775 #define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
776 #define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
777 #define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
778 #define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
779 #define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
780 #define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
781 #define GL_MATRIX0_ARB 0x88C0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
782 #define GL_MATRIX1_ARB 0x88C1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
783 #define GL_MATRIX2_ARB 0x88C2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
784 #define GL_MATRIX3_ARB 0x88C3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
785 #define GL_MATRIX4_ARB 0x88C4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
786 #define GL_MATRIX5_ARB 0x88C5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
787 #define GL_MATRIX6_ARB 0x88C6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
788 #define GL_MATRIX7_ARB 0x88C7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
789 #define GL_MATRIX8_ARB 0x88C8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
790 #define GL_MATRIX9_ARB 0x88C9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
791 #define GL_MATRIX10_ARB 0x88CA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
792 #define GL_MATRIX11_ARB 0x88CB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
793 #define GL_MATRIX12_ARB 0x88CC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
794 #define GL_MATRIX13_ARB 0x88CD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
795 #define GL_MATRIX14_ARB 0x88CE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
796 #define GL_MATRIX15_ARB 0x88CF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
797 #define GL_MATRIX16_ARB 0x88D0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
798 #define GL_MATRIX17_ARB 0x88D1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
799 #define GL_MATRIX18_ARB 0x88D2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
800 #define GL_MATRIX19_ARB 0x88D3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
801 #define GL_MATRIX20_ARB 0x88D4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
802 #define GL_MATRIX21_ARB 0x88D5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
803 #define GL_MATRIX22_ARB 0x88D6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
804 #define GL_MATRIX23_ARB 0x88D7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
805 #define GL_MATRIX24_ARB 0x88D8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
806 #define GL_MATRIX25_ARB 0x88D9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
807 #define GL_MATRIX26_ARB 0x88DA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
808 #define GL_MATRIX27_ARB 0x88DB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
809 #define GL_MATRIX28_ARB 0x88DC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
810 #define GL_MATRIX29_ARB 0x88DD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
811 #define GL_MATRIX30_ARB 0x88DE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
812 #define GL_MATRIX31_ARB 0x88DF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
813 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
814
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
815 #ifndef GL_ARB_fragment_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
816 #define GL_FRAGMENT_PROGRAM_ARB 0x8804
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
817 #define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
818 #define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
819 #define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
820 #define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
821 #define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
822 #define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
823 #define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
824 #define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
825 #define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
826 #define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
827 #define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
828 #define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
829 #define GL_MAX_TEXTURE_COORDS_ARB 0x8871
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
830 #define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
831 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
832
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
833 #ifndef GL_ARB_vertex_buffer_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
834 #define GL_BUFFER_SIZE_ARB 0x8764
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
835 #define GL_BUFFER_USAGE_ARB 0x8765
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
836 #define GL_ARRAY_BUFFER_ARB 0x8892
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
837 #define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
838 #define GL_ARRAY_BUFFER_BINDING_ARB 0x8894
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
839 #define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
840 #define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
841 #define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
842 #define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
843 #define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
844 #define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
845 #define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
846 #define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
847 #define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
848 #define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
849 #define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
850 #define GL_READ_ONLY_ARB 0x88B8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
851 #define GL_WRITE_ONLY_ARB 0x88B9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
852 #define GL_READ_WRITE_ARB 0x88BA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
853 #define GL_BUFFER_ACCESS_ARB 0x88BB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
854 #define GL_BUFFER_MAPPED_ARB 0x88BC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
855 #define GL_BUFFER_MAP_POINTER_ARB 0x88BD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
856 #define GL_STREAM_DRAW_ARB 0x88E0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
857 #define GL_STREAM_READ_ARB 0x88E1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
858 #define GL_STREAM_COPY_ARB 0x88E2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
859 #define GL_STATIC_DRAW_ARB 0x88E4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
860 #define GL_STATIC_READ_ARB 0x88E5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
861 #define GL_STATIC_COPY_ARB 0x88E6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
862 #define GL_DYNAMIC_DRAW_ARB 0x88E8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
863 #define GL_DYNAMIC_READ_ARB 0x88E9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
864 #define GL_DYNAMIC_COPY_ARB 0x88EA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
865 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
866
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
867 #ifndef GL_ARB_occlusion_query
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
868 #define GL_QUERY_COUNTER_BITS_ARB 0x8864
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
869 #define GL_CURRENT_QUERY_ARB 0x8865
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
870 #define GL_QUERY_RESULT_ARB 0x8866
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
871 #define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
872 #define GL_SAMPLES_PASSED_ARB 0x8914
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
873 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
874
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
875 #ifndef GL_ARB_shader_objects
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
876 #define GL_PROGRAM_OBJECT_ARB 0x8B40
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
877 #define GL_SHADER_OBJECT_ARB 0x8B48
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
878 #define GL_OBJECT_TYPE_ARB 0x8B4E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
879 #define GL_OBJECT_SUBTYPE_ARB 0x8B4F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
880 #define GL_FLOAT_VEC2_ARB 0x8B50
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
881 #define GL_FLOAT_VEC3_ARB 0x8B51
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
882 #define GL_FLOAT_VEC4_ARB 0x8B52
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
883 #define GL_INT_VEC2_ARB 0x8B53
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
884 #define GL_INT_VEC3_ARB 0x8B54
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
885 #define GL_INT_VEC4_ARB 0x8B55
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
886 #define GL_BOOL_ARB 0x8B56
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
887 #define GL_BOOL_VEC2_ARB 0x8B57
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
888 #define GL_BOOL_VEC3_ARB 0x8B58
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
889 #define GL_BOOL_VEC4_ARB 0x8B59
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
890 #define GL_FLOAT_MAT2_ARB 0x8B5A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
891 #define GL_FLOAT_MAT3_ARB 0x8B5B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
892 #define GL_FLOAT_MAT4_ARB 0x8B5C
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
893 #define GL_SAMPLER_1D_ARB 0x8B5D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
894 #define GL_SAMPLER_2D_ARB 0x8B5E
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
895 #define GL_SAMPLER_3D_ARB 0x8B5F
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
896 #define GL_SAMPLER_CUBE_ARB 0x8B60
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
897 #define GL_SAMPLER_1D_SHADOW_ARB 0x8B61
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
898 #define GL_SAMPLER_2D_SHADOW_ARB 0x8B62
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
899 #define GL_SAMPLER_2D_RECT_ARB 0x8B63
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
900 #define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
901 #define GL_OBJECT_DELETE_STATUS_ARB 0x8B80
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
902 #define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
903 #define GL_OBJECT_LINK_STATUS_ARB 0x8B82
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
904 #define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
905 #define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
906 #define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
907 #define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
908 #define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
909 #define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
910 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
911
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
912 #ifndef GL_ARB_vertex_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
913 #define GL_VERTEX_SHADER_ARB 0x8B31
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
914 #define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
915 #define GL_MAX_VARYING_FLOATS_ARB 0x8B4B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
916 #define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
917 #define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
918 #define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
919 #define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
920 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
921
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
922 #ifndef GL_ARB_fragment_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
923 #define GL_FRAGMENT_SHADER_ARB 0x8B30
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
924 #define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
925 #define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
926 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
927
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
928 #ifndef GL_ARB_shading_language_100
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
929 #define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
930 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
931
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
932 #ifndef GL_ARB_texture_non_power_of_two
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
933 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
934
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
935 #ifndef GL_ARB_point_sprite
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
936 #define GL_POINT_SPRITE_ARB 0x8861
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
937 #define GL_COORD_REPLACE_ARB 0x8862
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
938 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
939
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
940 #ifndef GL_ARB_fragment_program_shadow
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
941 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
942
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
943 #ifndef GL_ARB_draw_buffers
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
944 #define GL_MAX_DRAW_BUFFERS_ARB 0x8824
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
945 #define GL_DRAW_BUFFER0_ARB 0x8825
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
946 #define GL_DRAW_BUFFER1_ARB 0x8826
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
947 #define GL_DRAW_BUFFER2_ARB 0x8827
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
948 #define GL_DRAW_BUFFER3_ARB 0x8828
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
949 #define GL_DRAW_BUFFER4_ARB 0x8829
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
950 #define GL_DRAW_BUFFER5_ARB 0x882A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
951 #define GL_DRAW_BUFFER6_ARB 0x882B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
952 #define GL_DRAW_BUFFER7_ARB 0x882C
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
953 #define GL_DRAW_BUFFER8_ARB 0x882D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
954 #define GL_DRAW_BUFFER9_ARB 0x882E
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
955 #define GL_DRAW_BUFFER10_ARB 0x882F
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
956 #define GL_DRAW_BUFFER11_ARB 0x8830
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
957 #define GL_DRAW_BUFFER12_ARB 0x8831
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
958 #define GL_DRAW_BUFFER13_ARB 0x8832
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
959 #define GL_DRAW_BUFFER14_ARB 0x8833
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
960 #define GL_DRAW_BUFFER15_ARB 0x8834
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
961 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
962
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
963 #ifndef GL_ARB_texture_rectangle
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
964 #define GL_TEXTURE_RECTANGLE_ARB 0x84F5
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
965 #define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
966 #define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
967 #define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
968 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
969
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
970 #ifndef GL_ARB_color_buffer_float
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
971 #define GL_RGBA_FLOAT_MODE_ARB 0x8820
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
972 #define GL_CLAMP_VERTEX_COLOR_ARB 0x891A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
973 #define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
974 #define GL_CLAMP_READ_COLOR_ARB 0x891C
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
975 #define GL_FIXED_ONLY_ARB 0x891D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
976 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
977
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
978 #ifndef GL_ARB_half_float_pixel
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
979 #define GL_HALF_FLOAT_ARB 0x140B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
980 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
981
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
982 #ifndef GL_ARB_texture_float
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
983 #define GL_TEXTURE_RED_TYPE_ARB 0x8C10
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
984 #define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
985 #define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
986 #define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
987 #define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
988 #define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
989 #define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
990 #define GL_UNSIGNED_NORMALIZED_ARB 0x8C17
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
991 #define GL_RGBA32F_ARB 0x8814
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
992 #define GL_RGB32F_ARB 0x8815
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
993 #define GL_ALPHA32F_ARB 0x8816
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
994 #define GL_INTENSITY32F_ARB 0x8817
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
995 #define GL_LUMINANCE32F_ARB 0x8818
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
996 #define GL_LUMINANCE_ALPHA32F_ARB 0x8819
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
997 #define GL_RGBA16F_ARB 0x881A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
998 #define GL_RGB16F_ARB 0x881B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
999 #define GL_ALPHA16F_ARB 0x881C
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1000 #define GL_INTENSITY16F_ARB 0x881D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1001 #define GL_LUMINANCE16F_ARB 0x881E
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1002 #define GL_LUMINANCE_ALPHA16F_ARB 0x881F
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1003 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1004
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1005 #ifndef GL_ARB_pixel_buffer_object
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1006 #define GL_PIXEL_PACK_BUFFER_ARB 0x88EB
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1007 #define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1008 #define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1009 #define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1010 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1011
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1012 #ifndef GL_EXT_abgr
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1013 #define GL_ABGR_EXT 0x8000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1014 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1015
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1016 #ifndef GL_EXT_blend_color
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1017 #define GL_CONSTANT_COLOR_EXT 0x8001
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1018 #define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1019 #define GL_CONSTANT_ALPHA_EXT 0x8003
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1020 #define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1021 #define GL_BLEND_COLOR_EXT 0x8005
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1022 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1023
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1024 #ifndef GL_EXT_polygon_offset
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1025 #define GL_POLYGON_OFFSET_EXT 0x8037
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1026 #define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1027 #define GL_POLYGON_OFFSET_BIAS_EXT 0x8039
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1028 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1029
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1030 #ifndef GL_EXT_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1031 #define GL_ALPHA4_EXT 0x803B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1032 #define GL_ALPHA8_EXT 0x803C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1033 #define GL_ALPHA12_EXT 0x803D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1034 #define GL_ALPHA16_EXT 0x803E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1035 #define GL_LUMINANCE4_EXT 0x803F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1036 #define GL_LUMINANCE8_EXT 0x8040
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1037 #define GL_LUMINANCE12_EXT 0x8041
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1038 #define GL_LUMINANCE16_EXT 0x8042
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1039 #define GL_LUMINANCE4_ALPHA4_EXT 0x8043
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1040 #define GL_LUMINANCE6_ALPHA2_EXT 0x8044
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1041 #define GL_LUMINANCE8_ALPHA8_EXT 0x8045
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1042 #define GL_LUMINANCE12_ALPHA4_EXT 0x8046
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1043 #define GL_LUMINANCE12_ALPHA12_EXT 0x8047
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1044 #define GL_LUMINANCE16_ALPHA16_EXT 0x8048
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1045 #define GL_INTENSITY_EXT 0x8049
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1046 #define GL_INTENSITY4_EXT 0x804A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1047 #define GL_INTENSITY8_EXT 0x804B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1048 #define GL_INTENSITY12_EXT 0x804C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1049 #define GL_INTENSITY16_EXT 0x804D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1050 #define GL_RGB2_EXT 0x804E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1051 #define GL_RGB4_EXT 0x804F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1052 #define GL_RGB5_EXT 0x8050
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1053 #define GL_RGB8_EXT 0x8051
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1054 #define GL_RGB10_EXT 0x8052
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1055 #define GL_RGB12_EXT 0x8053
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1056 #define GL_RGB16_EXT 0x8054
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1057 #define GL_RGBA2_EXT 0x8055
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1058 #define GL_RGBA4_EXT 0x8056
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1059 #define GL_RGB5_A1_EXT 0x8057
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1060 #define GL_RGBA8_EXT 0x8058
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1061 #define GL_RGB10_A2_EXT 0x8059
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1062 #define GL_RGBA12_EXT 0x805A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1063 #define GL_RGBA16_EXT 0x805B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1064 #define GL_TEXTURE_RED_SIZE_EXT 0x805C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1065 #define GL_TEXTURE_GREEN_SIZE_EXT 0x805D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1066 #define GL_TEXTURE_BLUE_SIZE_EXT 0x805E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1067 #define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1068 #define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1069 #define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1070 #define GL_REPLACE_EXT 0x8062
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1071 #define GL_PROXY_TEXTURE_1D_EXT 0x8063
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1072 #define GL_PROXY_TEXTURE_2D_EXT 0x8064
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1073 #define GL_TEXTURE_TOO_LARGE_EXT 0x8065
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1074 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1075
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1076 #ifndef GL_EXT_texture3D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1077 #define GL_PACK_SKIP_IMAGES_EXT 0x806B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1078 #define GL_PACK_IMAGE_HEIGHT_EXT 0x806C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1079 #define GL_UNPACK_SKIP_IMAGES_EXT 0x806D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1080 #define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1081 #define GL_TEXTURE_3D_EXT 0x806F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1082 #define GL_PROXY_TEXTURE_3D_EXT 0x8070
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1083 #define GL_TEXTURE_DEPTH_EXT 0x8071
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1084 #define GL_TEXTURE_WRAP_R_EXT 0x8072
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1085 #define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1086 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1087
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1088 #ifndef GL_SGIS_texture_filter4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1089 #define GL_FILTER4_SGIS 0x8146
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1090 #define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1091 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1092
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1093 #ifndef GL_EXT_subtexture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1094 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1095
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1096 #ifndef GL_EXT_copy_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1097 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1098
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1099 #ifndef GL_EXT_histogram
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1100 #define GL_HISTOGRAM_EXT 0x8024
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1101 #define GL_PROXY_HISTOGRAM_EXT 0x8025
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1102 #define GL_HISTOGRAM_WIDTH_EXT 0x8026
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1103 #define GL_HISTOGRAM_FORMAT_EXT 0x8027
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1104 #define GL_HISTOGRAM_RED_SIZE_EXT 0x8028
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1105 #define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1106 #define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1107 #define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1108 #define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1109 #define GL_HISTOGRAM_SINK_EXT 0x802D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1110 #define GL_MINMAX_EXT 0x802E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1111 #define GL_MINMAX_FORMAT_EXT 0x802F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1112 #define GL_MINMAX_SINK_EXT 0x8030
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1113 #define GL_TABLE_TOO_LARGE_EXT 0x8031
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1114 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1115
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1116 #ifndef GL_EXT_convolution
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1117 #define GL_CONVOLUTION_1D_EXT 0x8010
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1118 #define GL_CONVOLUTION_2D_EXT 0x8011
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1119 #define GL_SEPARABLE_2D_EXT 0x8012
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1120 #define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1121 #define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1122 #define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1123 #define GL_REDUCE_EXT 0x8016
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1124 #define GL_CONVOLUTION_FORMAT_EXT 0x8017
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1125 #define GL_CONVOLUTION_WIDTH_EXT 0x8018
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1126 #define GL_CONVOLUTION_HEIGHT_EXT 0x8019
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1127 #define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1128 #define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1129 #define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1130 #define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1131 #define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1132 #define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1133 #define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1134 #define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1135 #define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1136 #define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1137 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1138
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1139 #ifndef GL_SGI_color_matrix
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1140 #define GL_COLOR_MATRIX_SGI 0x80B1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1141 #define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1142 #define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1143 #define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1144 #define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1145 #define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1146 #define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1147 #define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1148 #define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1149 #define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1150 #define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1151 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1152
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1153 #ifndef GL_SGI_color_table
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1154 #define GL_COLOR_TABLE_SGI 0x80D0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1155 #define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1156 #define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1157 #define GL_PROXY_COLOR_TABLE_SGI 0x80D3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1158 #define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1159 #define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1160 #define GL_COLOR_TABLE_SCALE_SGI 0x80D6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1161 #define GL_COLOR_TABLE_BIAS_SGI 0x80D7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1162 #define GL_COLOR_TABLE_FORMAT_SGI 0x80D8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1163 #define GL_COLOR_TABLE_WIDTH_SGI 0x80D9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1164 #define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1165 #define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1166 #define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1167 #define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1168 #define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1169 #define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1170 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1171
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1172 #ifndef GL_SGIS_pixel_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1173 #define GL_PIXEL_TEXTURE_SGIS 0x8353
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1174 #define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1175 #define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1176 #define GL_PIXEL_GROUP_COLOR_SGIS 0x8356
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1177 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1178
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1179 #ifndef GL_SGIX_pixel_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1180 #define GL_PIXEL_TEX_GEN_SGIX 0x8139
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1181 #define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1182 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1183
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1184 #ifndef GL_SGIS_texture4D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1185 #define GL_PACK_SKIP_VOLUMES_SGIS 0x8130
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1186 #define GL_PACK_IMAGE_DEPTH_SGIS 0x8131
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1187 #define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1188 #define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1189 #define GL_TEXTURE_4D_SGIS 0x8134
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1190 #define GL_PROXY_TEXTURE_4D_SGIS 0x8135
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1191 #define GL_TEXTURE_4DSIZE_SGIS 0x8136
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1192 #define GL_TEXTURE_WRAP_Q_SGIS 0x8137
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1193 #define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1194 #define GL_TEXTURE_4D_BINDING_SGIS 0x814F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1195 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1196
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1197 #ifndef GL_SGI_texture_color_table
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1198 #define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1199 #define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1200 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1201
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1202 #ifndef GL_EXT_cmyka
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1203 #define GL_CMYK_EXT 0x800C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1204 #define GL_CMYKA_EXT 0x800D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1205 #define GL_PACK_CMYK_HINT_EXT 0x800E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1206 #define GL_UNPACK_CMYK_HINT_EXT 0x800F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1207 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1208
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1209 #ifndef GL_EXT_texture_object
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1210 #define GL_TEXTURE_PRIORITY_EXT 0x8066
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1211 #define GL_TEXTURE_RESIDENT_EXT 0x8067
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1212 #define GL_TEXTURE_1D_BINDING_EXT 0x8068
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1213 #define GL_TEXTURE_2D_BINDING_EXT 0x8069
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1214 #define GL_TEXTURE_3D_BINDING_EXT 0x806A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1215 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1216
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1217 #ifndef GL_SGIS_detail_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1218 #define GL_DETAIL_TEXTURE_2D_SGIS 0x8095
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1219 #define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1220 #define GL_LINEAR_DETAIL_SGIS 0x8097
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1221 #define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1222 #define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1223 #define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1224 #define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1225 #define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1226 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1227
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1228 #ifndef GL_SGIS_sharpen_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1229 #define GL_LINEAR_SHARPEN_SGIS 0x80AD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1230 #define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1231 #define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1232 #define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1233 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1234
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1235 #ifndef GL_EXT_packed_pixels
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1236 #define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1237 #define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1238 #define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1239 #define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1240 #define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1241 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1242
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1243 #ifndef GL_SGIS_texture_lod
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1244 #define GL_TEXTURE_MIN_LOD_SGIS 0x813A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1245 #define GL_TEXTURE_MAX_LOD_SGIS 0x813B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1246 #define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1247 #define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1248 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1249
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1250 #ifndef GL_SGIS_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1251 #define GL_MULTISAMPLE_SGIS 0x809D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1252 #define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1253 #define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1254 #define GL_SAMPLE_MASK_SGIS 0x80A0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1255 #define GL_1PASS_SGIS 0x80A1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1256 #define GL_2PASS_0_SGIS 0x80A2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1257 #define GL_2PASS_1_SGIS 0x80A3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1258 #define GL_4PASS_0_SGIS 0x80A4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1259 #define GL_4PASS_1_SGIS 0x80A5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1260 #define GL_4PASS_2_SGIS 0x80A6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1261 #define GL_4PASS_3_SGIS 0x80A7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1262 #define GL_SAMPLE_BUFFERS_SGIS 0x80A8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1263 #define GL_SAMPLES_SGIS 0x80A9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1264 #define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1265 #define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1266 #define GL_SAMPLE_PATTERN_SGIS 0x80AC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1267 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1268
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1269 #ifndef GL_EXT_rescale_normal
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1270 #define GL_RESCALE_NORMAL_EXT 0x803A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1271 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1272
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1273 #ifndef GL_EXT_vertex_array
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1274 #define GL_VERTEX_ARRAY_EXT 0x8074
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1275 #define GL_NORMAL_ARRAY_EXT 0x8075
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1276 #define GL_COLOR_ARRAY_EXT 0x8076
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1277 #define GL_INDEX_ARRAY_EXT 0x8077
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1278 #define GL_TEXTURE_COORD_ARRAY_EXT 0x8078
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1279 #define GL_EDGE_FLAG_ARRAY_EXT 0x8079
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1280 #define GL_VERTEX_ARRAY_SIZE_EXT 0x807A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1281 #define GL_VERTEX_ARRAY_TYPE_EXT 0x807B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1282 #define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1283 #define GL_VERTEX_ARRAY_COUNT_EXT 0x807D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1284 #define GL_NORMAL_ARRAY_TYPE_EXT 0x807E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1285 #define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1286 #define GL_NORMAL_ARRAY_COUNT_EXT 0x8080
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1287 #define GL_COLOR_ARRAY_SIZE_EXT 0x8081
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1288 #define GL_COLOR_ARRAY_TYPE_EXT 0x8082
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1289 #define GL_COLOR_ARRAY_STRIDE_EXT 0x8083
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1290 #define GL_COLOR_ARRAY_COUNT_EXT 0x8084
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1291 #define GL_INDEX_ARRAY_TYPE_EXT 0x8085
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1292 #define GL_INDEX_ARRAY_STRIDE_EXT 0x8086
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1293 #define GL_INDEX_ARRAY_COUNT_EXT 0x8087
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1294 #define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1295 #define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1296 #define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1297 #define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1298 #define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1299 #define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1300 #define GL_VERTEX_ARRAY_POINTER_EXT 0x808E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1301 #define GL_NORMAL_ARRAY_POINTER_EXT 0x808F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1302 #define GL_COLOR_ARRAY_POINTER_EXT 0x8090
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1303 #define GL_INDEX_ARRAY_POINTER_EXT 0x8091
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1304 #define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1305 #define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1306 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1307
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1308 #ifndef GL_EXT_misc_attribute
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1309 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1310
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1311 #ifndef GL_SGIS_generate_mipmap
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1312 #define GL_GENERATE_MIPMAP_SGIS 0x8191
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1313 #define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1314 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1315
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1316 #ifndef GL_SGIX_clipmap
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1317 #define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1318 #define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1319 #define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1320 #define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1321 #define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1322 #define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1323 #define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1324 #define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1325 #define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1326 #define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1327 #define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1328 #define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1329 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1330
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1331 #ifndef GL_SGIX_shadow
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1332 #define GL_TEXTURE_COMPARE_SGIX 0x819A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1333 #define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1334 #define GL_TEXTURE_LEQUAL_R_SGIX 0x819C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1335 #define GL_TEXTURE_GEQUAL_R_SGIX 0x819D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1336 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1337
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1338 #ifndef GL_SGIS_texture_edge_clamp
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1339 #define GL_CLAMP_TO_EDGE_SGIS 0x812F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1340 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1341
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1342 #ifndef GL_SGIS_texture_border_clamp
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1343 #define GL_CLAMP_TO_BORDER_SGIS 0x812D
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1344 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
1345
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1346 #ifndef GL_EXT_blend_minmax
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1347 #define GL_FUNC_ADD_EXT 0x8006
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1348 #define GL_MIN_EXT 0x8007
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1349 #define GL_MAX_EXT 0x8008
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1350 #define GL_BLEND_EQUATION_EXT 0x8009
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1351 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1352
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1353 #ifndef GL_EXT_blend_subtract
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1354 #define GL_FUNC_SUBTRACT_EXT 0x800A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1355 #define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1356 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1357
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1358 #ifndef GL_EXT_blend_logic_op
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1359 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1360
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1361 #ifndef GL_SGIX_interlace
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1362 #define GL_INTERLACE_SGIX 0x8094
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1363 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1364
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1365 #ifndef GL_SGIX_pixel_tiles
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1366 #define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1367 #define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1368 #define GL_PIXEL_TILE_WIDTH_SGIX 0x8140
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1369 #define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1370 #define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1371 #define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1372 #define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1373 #define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1374 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1375
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1376 #ifndef GL_SGIS_texture_select
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1377 #define GL_DUAL_ALPHA4_SGIS 0x8110
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1378 #define GL_DUAL_ALPHA8_SGIS 0x8111
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1379 #define GL_DUAL_ALPHA12_SGIS 0x8112
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1380 #define GL_DUAL_ALPHA16_SGIS 0x8113
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1381 #define GL_DUAL_LUMINANCE4_SGIS 0x8114
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1382 #define GL_DUAL_LUMINANCE8_SGIS 0x8115
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1383 #define GL_DUAL_LUMINANCE12_SGIS 0x8116
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1384 #define GL_DUAL_LUMINANCE16_SGIS 0x8117
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1385 #define GL_DUAL_INTENSITY4_SGIS 0x8118
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1386 #define GL_DUAL_INTENSITY8_SGIS 0x8119
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1387 #define GL_DUAL_INTENSITY12_SGIS 0x811A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1388 #define GL_DUAL_INTENSITY16_SGIS 0x811B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1389 #define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1390 #define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1391 #define GL_QUAD_ALPHA4_SGIS 0x811E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1392 #define GL_QUAD_ALPHA8_SGIS 0x811F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1393 #define GL_QUAD_LUMINANCE4_SGIS 0x8120
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1394 #define GL_QUAD_LUMINANCE8_SGIS 0x8121
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1395 #define GL_QUAD_INTENSITY4_SGIS 0x8122
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1396 #define GL_QUAD_INTENSITY8_SGIS 0x8123
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1397 #define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1398 #define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1399 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1400
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1401 #ifndef GL_SGIX_sprite
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1402 #define GL_SPRITE_SGIX 0x8148
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1403 #define GL_SPRITE_MODE_SGIX 0x8149
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1404 #define GL_SPRITE_AXIS_SGIX 0x814A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1405 #define GL_SPRITE_TRANSLATION_SGIX 0x814B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1406 #define GL_SPRITE_AXIAL_SGIX 0x814C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1407 #define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1408 #define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1409 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1410
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1411 #ifndef GL_SGIX_texture_multi_buffer
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1412 #define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1413 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1414
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1415 #ifndef GL_EXT_point_parameters
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1416 #define GL_POINT_SIZE_MIN_EXT 0x8126
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1417 #define GL_POINT_SIZE_MAX_EXT 0x8127
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1418 #define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1419 #define GL_DISTANCE_ATTENUATION_EXT 0x8129
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1420 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1421
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1422 #ifndef GL_SGIS_point_parameters
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1423 #define GL_POINT_SIZE_MIN_SGIS 0x8126
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1424 #define GL_POINT_SIZE_MAX_SGIS 0x8127
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1425 #define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1426 #define GL_DISTANCE_ATTENUATION_SGIS 0x8129
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1427 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1428
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1429 #ifndef GL_SGIX_instruments
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1430 #define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1431 #define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1432 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1433
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1434 #ifndef GL_SGIX_texture_scale_bias
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1435 #define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1436 #define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1437 #define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1438 #define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1439 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1440
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1441 #ifndef GL_SGIX_framezoom
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1442 #define GL_FRAMEZOOM_SGIX 0x818B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1443 #define GL_FRAMEZOOM_FACTOR_SGIX 0x818C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1444 #define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1445 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1446
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1447 #ifndef GL_SGIX_tag_sample_buffer
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1448 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1449
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1450 #ifndef GL_FfdMaskSGIX
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1451 #define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1452 #define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1453 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1454
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1455 #ifndef GL_SGIX_polynomial_ffd
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1456 #define GL_GEOMETRY_DEFORMATION_SGIX 0x8194
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1457 #define GL_TEXTURE_DEFORMATION_SGIX 0x8195
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1458 #define GL_DEFORMATIONS_MASK_SGIX 0x8196
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1459 #define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1460 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1461
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1462 #ifndef GL_SGIX_reference_plane
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1463 #define GL_REFERENCE_PLANE_SGIX 0x817D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1464 #define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1465 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1466
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1467 #ifndef GL_SGIX_flush_raster
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1468 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1469
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1470 #ifndef GL_SGIX_depth_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1471 #define GL_DEPTH_COMPONENT16_SGIX 0x81A5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1472 #define GL_DEPTH_COMPONENT24_SGIX 0x81A6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1473 #define GL_DEPTH_COMPONENT32_SGIX 0x81A7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1474 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1475
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1476 #ifndef GL_SGIS_fog_function
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1477 #define GL_FOG_FUNC_SGIS 0x812A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1478 #define GL_FOG_FUNC_POINTS_SGIS 0x812B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1479 #define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1480 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1481
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1482 #ifndef GL_SGIX_fog_offset
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1483 #define GL_FOG_OFFSET_SGIX 0x8198
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1484 #define GL_FOG_OFFSET_VALUE_SGIX 0x8199
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1485 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1486
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1487 #ifndef GL_HP_image_transform
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1488 #define GL_IMAGE_SCALE_X_HP 0x8155
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1489 #define GL_IMAGE_SCALE_Y_HP 0x8156
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1490 #define GL_IMAGE_TRANSLATE_X_HP 0x8157
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1491 #define GL_IMAGE_TRANSLATE_Y_HP 0x8158
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1492 #define GL_IMAGE_ROTATE_ANGLE_HP 0x8159
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1493 #define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1494 #define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1495 #define GL_IMAGE_MAG_FILTER_HP 0x815C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1496 #define GL_IMAGE_MIN_FILTER_HP 0x815D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1497 #define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1498 #define GL_CUBIC_HP 0x815F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1499 #define GL_AVERAGE_HP 0x8160
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1500 #define GL_IMAGE_TRANSFORM_2D_HP 0x8161
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1501 #define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1502 #define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1503 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1504
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1505 #ifndef GL_HP_convolution_border_modes
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1506 #define GL_IGNORE_BORDER_HP 0x8150
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1507 #define GL_CONSTANT_BORDER_HP 0x8151
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1508 #define GL_REPLICATE_BORDER_HP 0x8153
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1509 #define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1510 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1511
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1512 #ifndef GL_INGR_palette_buffer
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1513 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1514
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1515 #ifndef GL_SGIX_texture_add_env
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1516 #define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1517 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1518
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1519 #ifndef GL_EXT_color_subtable
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1520 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1521
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1522 #ifndef GL_PGI_vertex_hints
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1523 #define GL_VERTEX_DATA_HINT_PGI 0x1A22A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1524 #define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1525 #define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1526 #define GL_MAX_VERTEX_HINT_PGI 0x1A22D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1527 #define GL_COLOR3_BIT_PGI 0x00010000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1528 #define GL_COLOR4_BIT_PGI 0x00020000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1529 #define GL_EDGEFLAG_BIT_PGI 0x00040000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1530 #define GL_INDEX_BIT_PGI 0x00080000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1531 #define GL_MAT_AMBIENT_BIT_PGI 0x00100000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1532 #define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1533 #define GL_MAT_DIFFUSE_BIT_PGI 0x00400000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1534 #define GL_MAT_EMISSION_BIT_PGI 0x00800000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1535 #define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1536 #define GL_MAT_SHININESS_BIT_PGI 0x02000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1537 #define GL_MAT_SPECULAR_BIT_PGI 0x04000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1538 #define GL_NORMAL_BIT_PGI 0x08000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1539 #define GL_TEXCOORD1_BIT_PGI 0x10000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1540 #define GL_TEXCOORD2_BIT_PGI 0x20000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1541 #define GL_TEXCOORD3_BIT_PGI 0x40000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1542 #define GL_TEXCOORD4_BIT_PGI 0x80000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1543 #define GL_VERTEX23_BIT_PGI 0x00000004
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1544 #define GL_VERTEX4_BIT_PGI 0x00000008
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1545 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1546
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1547 #ifndef GL_PGI_misc_hints
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1548 #define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1549 #define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1550 #define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1551 #define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1552 #define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1553 #define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1554 #define GL_ALWAYS_FAST_HINT_PGI 0x1A20C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1555 #define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1556 #define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1557 #define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1558 #define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1559 #define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1560 #define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1561 #define GL_STRICT_LIGHTING_HINT_PGI 0x1A217
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1562 #define GL_STRICT_SCISSOR_HINT_PGI 0x1A218
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1563 #define GL_FULL_STIPPLE_HINT_PGI 0x1A219
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1564 #define GL_CLIP_NEAR_HINT_PGI 0x1A220
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1565 #define GL_CLIP_FAR_HINT_PGI 0x1A221
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1566 #define GL_WIDE_LINE_HINT_PGI 0x1A222
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1567 #define GL_BACK_NORMALS_HINT_PGI 0x1A223
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1568 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1569
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1570 #ifndef GL_EXT_paletted_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1571 #define GL_COLOR_INDEX1_EXT 0x80E2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1572 #define GL_COLOR_INDEX2_EXT 0x80E3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1573 #define GL_COLOR_INDEX4_EXT 0x80E4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1574 #define GL_COLOR_INDEX8_EXT 0x80E5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1575 #define GL_COLOR_INDEX12_EXT 0x80E6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1576 #define GL_COLOR_INDEX16_EXT 0x80E7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1577 #define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1578 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1579
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1580 #ifndef GL_EXT_clip_volume_hint
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1581 #define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1582 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1583
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1584 #ifndef GL_SGIX_list_priority
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1585 #define GL_LIST_PRIORITY_SGIX 0x8182
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1586 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1587
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1588 #ifndef GL_SGIX_ir_instrument1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1589 #define GL_IR_INSTRUMENT1_SGIX 0x817F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1590 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1591
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1592 #ifndef GL_SGIX_calligraphic_fragment
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1593 #define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1594 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1595
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1596 #ifndef GL_SGIX_texture_lod_bias
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1597 #define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1598 #define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1599 #define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1600 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1601
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1602 #ifndef GL_SGIX_shadow_ambient
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1603 #define GL_SHADOW_AMBIENT_SGIX 0x80BF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1604 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1605
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1606 #ifndef GL_EXT_index_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1607 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1608
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1609 #ifndef GL_EXT_index_material
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1610 #define GL_INDEX_MATERIAL_EXT 0x81B8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1611 #define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1612 #define GL_INDEX_MATERIAL_FACE_EXT 0x81BA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1613 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1614
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1615 #ifndef GL_EXT_index_func
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1616 #define GL_INDEX_TEST_EXT 0x81B5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1617 #define GL_INDEX_TEST_FUNC_EXT 0x81B6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1618 #define GL_INDEX_TEST_REF_EXT 0x81B7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1619 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1620
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1621 #ifndef GL_EXT_index_array_formats
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1622 #define GL_IUI_V2F_EXT 0x81AD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1623 #define GL_IUI_V3F_EXT 0x81AE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1624 #define GL_IUI_N3F_V2F_EXT 0x81AF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1625 #define GL_IUI_N3F_V3F_EXT 0x81B0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1626 #define GL_T2F_IUI_V2F_EXT 0x81B1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1627 #define GL_T2F_IUI_V3F_EXT 0x81B2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1628 #define GL_T2F_IUI_N3F_V2F_EXT 0x81B3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1629 #define GL_T2F_IUI_N3F_V3F_EXT 0x81B4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1630 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1631
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1632 #ifndef GL_EXT_compiled_vertex_array
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1633 #define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1634 #define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1635 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1636
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1637 #ifndef GL_EXT_cull_vertex
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1638 #define GL_CULL_VERTEX_EXT 0x81AA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1639 #define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1640 #define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1641 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1642
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1643 #ifndef GL_SGIX_ycrcb
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1644 #define GL_YCRCB_422_SGIX 0x81BB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1645 #define GL_YCRCB_444_SGIX 0x81BC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1646 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1647
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1648 #ifndef GL_SGIX_fragment_lighting
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1649 #define GL_FRAGMENT_LIGHTING_SGIX 0x8400
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1650 #define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1651 #define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1652 #define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1653 #define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1654 #define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1655 #define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1656 #define GL_LIGHT_ENV_MODE_SGIX 0x8407
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1657 #define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1658 #define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1659 #define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1660 #define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1661 #define GL_FRAGMENT_LIGHT0_SGIX 0x840C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1662 #define GL_FRAGMENT_LIGHT1_SGIX 0x840D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1663 #define GL_FRAGMENT_LIGHT2_SGIX 0x840E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1664 #define GL_FRAGMENT_LIGHT3_SGIX 0x840F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1665 #define GL_FRAGMENT_LIGHT4_SGIX 0x8410
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1666 #define GL_FRAGMENT_LIGHT5_SGIX 0x8411
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1667 #define GL_FRAGMENT_LIGHT6_SGIX 0x8412
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1668 #define GL_FRAGMENT_LIGHT7_SGIX 0x8413
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1669 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1670
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1671 #ifndef GL_IBM_rasterpos_clip
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1672 #define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1673 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1674
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1675 #ifndef GL_HP_texture_lighting
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1676 #define GL_TEXTURE_LIGHTING_MODE_HP 0x8167
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1677 #define GL_TEXTURE_POST_SPECULAR_HP 0x8168
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1678 #define GL_TEXTURE_PRE_SPECULAR_HP 0x8169
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1679 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1680
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1681 #ifndef GL_EXT_draw_range_elements
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1682 #define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1683 #define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1684 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1685
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1686 #ifndef GL_WIN_phong_shading
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1687 #define GL_PHONG_WIN 0x80EA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1688 #define GL_PHONG_HINT_WIN 0x80EB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1689 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1690
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1691 #ifndef GL_WIN_specular_fog
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1692 #define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1693 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1694
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1695 #ifndef GL_EXT_light_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1696 #define GL_FRAGMENT_MATERIAL_EXT 0x8349
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1697 #define GL_FRAGMENT_NORMAL_EXT 0x834A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1698 #define GL_FRAGMENT_COLOR_EXT 0x834C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1699 #define GL_ATTENUATION_EXT 0x834D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1700 #define GL_SHADOW_ATTENUATION_EXT 0x834E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1701 #define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1702 #define GL_TEXTURE_LIGHT_EXT 0x8350
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1703 #define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1704 #define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1705 /* reuse GL_FRAGMENT_DEPTH_EXT */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1706 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1707
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1708 #ifndef GL_SGIX_blend_alpha_minmax
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1709 #define GL_ALPHA_MIN_SGIX 0x8320
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1710 #define GL_ALPHA_MAX_SGIX 0x8321
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1711 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1712
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1713 #ifndef GL_SGIX_impact_pixel_texture
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1714 #define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX 0x8184
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1715 #define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX 0x8185
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1716 #define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX 0x8186
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1717 #define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1718 #define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1719 #define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX 0x8189
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1720 #define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX 0x818A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1721 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1722
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1723 #ifndef GL_EXT_bgra
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1724 #define GL_BGR_EXT 0x80E0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1725 #define GL_BGRA_EXT 0x80E1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1726 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1727
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1728 #ifndef GL_SGIX_async
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1729 #define GL_ASYNC_MARKER_SGIX 0x8329
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1730 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1731
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1732 #ifndef GL_SGIX_async_pixel
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1733 #define GL_ASYNC_TEX_IMAGE_SGIX 0x835C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1734 #define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1735 #define GL_ASYNC_READ_PIXELS_SGIX 0x835E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1736 #define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1737 #define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1738 #define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1739 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1740
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1741 #ifndef GL_SGIX_async_histogram
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1742 #define GL_ASYNC_HISTOGRAM_SGIX 0x832C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1743 #define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1744 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1745
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1746 #ifndef GL_INTEL_texture_scissor
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1747 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1748
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1749 #ifndef GL_INTEL_parallel_arrays
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1750 #define GL_PARALLEL_ARRAYS_INTEL 0x83F4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1751 #define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1752 #define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1753 #define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1754 #define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1755 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1756
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1757 #ifndef GL_HP_occlusion_test
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1758 #define GL_OCCLUSION_TEST_HP 0x8165
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1759 #define GL_OCCLUSION_TEST_RESULT_HP 0x8166
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1760 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1761
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1762 #ifndef GL_EXT_pixel_transform
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1763 #define GL_PIXEL_TRANSFORM_2D_EXT 0x8330
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1764 #define GL_PIXEL_MAG_FILTER_EXT 0x8331
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1765 #define GL_PIXEL_MIN_FILTER_EXT 0x8332
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1766 #define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1767 #define GL_CUBIC_EXT 0x8334
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1768 #define GL_AVERAGE_EXT 0x8335
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1769 #define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1770 #define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1771 #define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1772 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1773
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1774 #ifndef GL_EXT_pixel_transform_color_table
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1775 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1776
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1777 #ifndef GL_EXT_shared_texture_palette
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1778 #define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1779 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1780
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1781 #ifndef GL_EXT_separate_specular_color
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1782 #define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1783 #define GL_SINGLE_COLOR_EXT 0x81F9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1784 #define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1785 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1786
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1787 #ifndef GL_EXT_secondary_color
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1788 #define GL_COLOR_SUM_EXT 0x8458
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1789 #define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1790 #define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1791 #define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1792 #define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1793 #define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1794 #define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1795 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1796
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1797 #ifndef GL_EXT_texture_perturb_normal
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1798 #define GL_PERTURB_EXT 0x85AE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1799 #define GL_TEXTURE_NORMAL_EXT 0x85AF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1800 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1801
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1802 #ifndef GL_EXT_multi_draw_arrays
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1803 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1804
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1805 #ifndef GL_EXT_fog_coord
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1806 #define GL_FOG_COORDINATE_SOURCE_EXT 0x8450
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1807 #define GL_FOG_COORDINATE_EXT 0x8451
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1808 #define GL_FRAGMENT_DEPTH_EXT 0x8452
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1809 #define GL_CURRENT_FOG_COORDINATE_EXT 0x8453
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1810 #define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1811 #define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1812 #define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1813 #define GL_FOG_COORDINATE_ARRAY_EXT 0x8457
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1814 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1815
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1816 #ifndef GL_REND_screen_coordinates
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1817 #define GL_SCREEN_COORDINATES_REND 0x8490
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1818 #define GL_INVERTED_SCREEN_W_REND 0x8491
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1819 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1820
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1821 #ifndef GL_EXT_coordinate_frame
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1822 #define GL_TANGENT_ARRAY_EXT 0x8439
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1823 #define GL_BINORMAL_ARRAY_EXT 0x843A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1824 #define GL_CURRENT_TANGENT_EXT 0x843B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1825 #define GL_CURRENT_BINORMAL_EXT 0x843C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1826 #define GL_TANGENT_ARRAY_TYPE_EXT 0x843E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1827 #define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1828 #define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1829 #define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1830 #define GL_TANGENT_ARRAY_POINTER_EXT 0x8442
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1831 #define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1832 #define GL_MAP1_TANGENT_EXT 0x8444
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1833 #define GL_MAP2_TANGENT_EXT 0x8445
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1834 #define GL_MAP1_BINORMAL_EXT 0x8446
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1835 #define GL_MAP2_BINORMAL_EXT 0x8447
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1836 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1837
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1838 #ifndef GL_EXT_texture_env_combine
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1839 #define GL_COMBINE_EXT 0x8570
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1840 #define GL_COMBINE_RGB_EXT 0x8571
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1841 #define GL_COMBINE_ALPHA_EXT 0x8572
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1842 #define GL_RGB_SCALE_EXT 0x8573
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1843 #define GL_ADD_SIGNED_EXT 0x8574
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1844 #define GL_INTERPOLATE_EXT 0x8575
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1845 #define GL_CONSTANT_EXT 0x8576
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1846 #define GL_PRIMARY_COLOR_EXT 0x8577
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1847 #define GL_PREVIOUS_EXT 0x8578
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1848 #define GL_SOURCE0_RGB_EXT 0x8580
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1849 #define GL_SOURCE1_RGB_EXT 0x8581
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1850 #define GL_SOURCE2_RGB_EXT 0x8582
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1851 #define GL_SOURCE0_ALPHA_EXT 0x8588
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1852 #define GL_SOURCE1_ALPHA_EXT 0x8589
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1853 #define GL_SOURCE2_ALPHA_EXT 0x858A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1854 #define GL_OPERAND0_RGB_EXT 0x8590
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1855 #define GL_OPERAND1_RGB_EXT 0x8591
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1856 #define GL_OPERAND2_RGB_EXT 0x8592
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1857 #define GL_OPERAND0_ALPHA_EXT 0x8598
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1858 #define GL_OPERAND1_ALPHA_EXT 0x8599
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1859 #define GL_OPERAND2_ALPHA_EXT 0x859A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1860 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1861
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1862 #ifndef GL_APPLE_specular_vector
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1863 #define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1864 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1865
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1866 #ifndef GL_APPLE_transform_hint
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1867 #define GL_TRANSFORM_HINT_APPLE 0x85B1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1868 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1869
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1870 #ifndef GL_SGIX_fog_scale
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1871 #define GL_FOG_SCALE_SGIX 0x81FC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1872 #define GL_FOG_SCALE_VALUE_SGIX 0x81FD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1873 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
1874
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1875 #ifndef GL_SUNX_constant_data
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1876 #define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1877 #define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1878 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1879
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1880 #ifndef GL_SUN_global_alpha
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1881 #define GL_GLOBAL_ALPHA_SUN 0x81D9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1882 #define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1883 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1884
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1885 #ifndef GL_SUN_triangle_list
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1886 #define GL_RESTART_SUN 0x0001
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1887 #define GL_REPLACE_MIDDLE_SUN 0x0002
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1888 #define GL_REPLACE_OLDEST_SUN 0x0003
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1889 #define GL_TRIANGLE_LIST_SUN 0x81D7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1890 #define GL_REPLACEMENT_CODE_SUN 0x81D8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1891 #define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1892 #define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1893 #define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1894 #define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1895 #define GL_R1UI_V3F_SUN 0x85C4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1896 #define GL_R1UI_C4UB_V3F_SUN 0x85C5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1897 #define GL_R1UI_C3F_V3F_SUN 0x85C6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1898 #define GL_R1UI_N3F_V3F_SUN 0x85C7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1899 #define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1900 #define GL_R1UI_T2F_V3F_SUN 0x85C9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1901 #define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1902 #define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1903 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1904
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1905 #ifndef GL_SUN_vertex
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1906 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1907
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1908 #ifndef GL_EXT_blend_func_separate
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1909 #define GL_BLEND_DST_RGB_EXT 0x80C8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1910 #define GL_BLEND_SRC_RGB_EXT 0x80C9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1911 #define GL_BLEND_DST_ALPHA_EXT 0x80CA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1912 #define GL_BLEND_SRC_ALPHA_EXT 0x80CB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1913 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1914
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1915 #ifndef GL_INGR_color_clamp
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1916 #define GL_RED_MIN_CLAMP_INGR 0x8560
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1917 #define GL_GREEN_MIN_CLAMP_INGR 0x8561
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1918 #define GL_BLUE_MIN_CLAMP_INGR 0x8562
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1919 #define GL_ALPHA_MIN_CLAMP_INGR 0x8563
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1920 #define GL_RED_MAX_CLAMP_INGR 0x8564
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1921 #define GL_GREEN_MAX_CLAMP_INGR 0x8565
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1922 #define GL_BLUE_MAX_CLAMP_INGR 0x8566
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1923 #define GL_ALPHA_MAX_CLAMP_INGR 0x8567
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1924 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1925
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1926 #ifndef GL_INGR_interlace_read
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1927 #define GL_INTERLACE_READ_INGR 0x8568
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1928 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1929
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1930 #ifndef GL_EXT_stencil_wrap
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1931 #define GL_INCR_WRAP_EXT 0x8507
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1932 #define GL_DECR_WRAP_EXT 0x8508
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1933 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1934
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1935 #ifndef GL_EXT_422_pixels
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1936 #define GL_422_EXT 0x80CC
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1937 #define GL_422_REV_EXT 0x80CD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1938 #define GL_422_AVERAGE_EXT 0x80CE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1939 #define GL_422_REV_AVERAGE_EXT 0x80CF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1940 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1941
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1942 #ifndef GL_NV_texgen_reflection
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1943 #define GL_NORMAL_MAP_NV 0x8511
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1944 #define GL_REFLECTION_MAP_NV 0x8512
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1945 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1946
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1947 #ifndef GL_EXT_texture_cube_map
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1948 #define GL_NORMAL_MAP_EXT 0x8511
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1949 #define GL_REFLECTION_MAP_EXT 0x8512
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1950 #define GL_TEXTURE_CUBE_MAP_EXT 0x8513
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1951 #define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1952 #define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1953 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1954 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1955 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1956 #define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1957 #define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1958 #define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1959 #define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1960 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1961
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1962 #ifndef GL_SUN_convolution_border_modes
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1963 #define GL_WRAP_BORDER_SUN 0x81D4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1964 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1965
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1966 #ifndef GL_EXT_texture_env_add
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1967 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1968
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1969 #ifndef GL_EXT_texture_lod_bias
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1970 #define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1971 #define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1972 #define GL_TEXTURE_LOD_BIAS_EXT 0x8501
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1973 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1974
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1975 #ifndef GL_EXT_texture_filter_anisotropic
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1976 #define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1977 #define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1978 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1979
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1980 #ifndef GL_EXT_vertex_weighting
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1981 #define GL_MODELVIEW0_STACK_DEPTH_EXT GL_MODELVIEW_STACK_DEPTH
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1982 #define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1983 #define GL_MODELVIEW0_MATRIX_EXT GL_MODELVIEW_MATRIX
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
1984 #define GL_MODELVIEW1_MATRIX_EXT 0x8506
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1985 #define GL_VERTEX_WEIGHTING_EXT 0x8509
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1986 #define GL_MODELVIEW0_EXT GL_MODELVIEW
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1987 #define GL_MODELVIEW1_EXT 0x850A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1988 #define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1989 #define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1990 #define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1991 #define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1992 #define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1993 #define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1994 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1995
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1996 #ifndef GL_NV_light_max_exponent
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1997 #define GL_MAX_SHININESS_NV 0x8504
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1998 #define GL_MAX_SPOT_EXPONENT_NV 0x8505
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
1999 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2001 #ifndef GL_NV_vertex_array_range
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2002 #define GL_VERTEX_ARRAY_RANGE_NV 0x851D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2003 #define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2004 #define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2005 #define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2006 #define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2007 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
2008
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2009 #ifndef GL_NV_register_combiners
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2010 #define GL_REGISTER_COMBINERS_NV 0x8522
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2011 #define GL_VARIABLE_A_NV 0x8523
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2012 #define GL_VARIABLE_B_NV 0x8524
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2013 #define GL_VARIABLE_C_NV 0x8525
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2014 #define GL_VARIABLE_D_NV 0x8526
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2015 #define GL_VARIABLE_E_NV 0x8527
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2016 #define GL_VARIABLE_F_NV 0x8528
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2017 #define GL_VARIABLE_G_NV 0x8529
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2018 #define GL_CONSTANT_COLOR0_NV 0x852A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2019 #define GL_CONSTANT_COLOR1_NV 0x852B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2020 #define GL_PRIMARY_COLOR_NV 0x852C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2021 #define GL_SECONDARY_COLOR_NV 0x852D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2022 #define GL_SPARE0_NV 0x852E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2023 #define GL_SPARE1_NV 0x852F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2024 #define GL_DISCARD_NV 0x8530
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2025 #define GL_E_TIMES_F_NV 0x8531
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2026 #define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2027 #define GL_UNSIGNED_IDENTITY_NV 0x8536
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2028 #define GL_UNSIGNED_INVERT_NV 0x8537
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2029 #define GL_EXPAND_NORMAL_NV 0x8538
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2030 #define GL_EXPAND_NEGATE_NV 0x8539
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2031 #define GL_HALF_BIAS_NORMAL_NV 0x853A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2032 #define GL_HALF_BIAS_NEGATE_NV 0x853B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2033 #define GL_SIGNED_IDENTITY_NV 0x853C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2034 #define GL_SIGNED_NEGATE_NV 0x853D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2035 #define GL_SCALE_BY_TWO_NV 0x853E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2036 #define GL_SCALE_BY_FOUR_NV 0x853F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2037 #define GL_SCALE_BY_ONE_HALF_NV 0x8540
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2038 #define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2039 #define GL_COMBINER_INPUT_NV 0x8542
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2040 #define GL_COMBINER_MAPPING_NV 0x8543
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2041 #define GL_COMBINER_COMPONENT_USAGE_NV 0x8544
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2042 #define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2043 #define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2044 #define GL_COMBINER_MUX_SUM_NV 0x8547
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2045 #define GL_COMBINER_SCALE_NV 0x8548
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2046 #define GL_COMBINER_BIAS_NV 0x8549
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2047 #define GL_COMBINER_AB_OUTPUT_NV 0x854A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2048 #define GL_COMBINER_CD_OUTPUT_NV 0x854B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2049 #define GL_COMBINER_SUM_OUTPUT_NV 0x854C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2050 #define GL_MAX_GENERAL_COMBINERS_NV 0x854D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2051 #define GL_NUM_GENERAL_COMBINERS_NV 0x854E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2052 #define GL_COLOR_SUM_CLAMP_NV 0x854F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2053 #define GL_COMBINER0_NV 0x8550
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2054 #define GL_COMBINER1_NV 0x8551
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2055 #define GL_COMBINER2_NV 0x8552
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2056 #define GL_COMBINER3_NV 0x8553
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2057 #define GL_COMBINER4_NV 0x8554
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2058 #define GL_COMBINER5_NV 0x8555
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2059 #define GL_COMBINER6_NV 0x8556
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2060 #define GL_COMBINER7_NV 0x8557
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2061 /* reuse GL_TEXTURE0_ARB */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2062 /* reuse GL_TEXTURE1_ARB */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2063 /* reuse GL_ZERO */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2064 /* reuse GL_NONE */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2065 /* reuse GL_FOG */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2066 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
2067
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2068 #ifndef GL_NV_fog_distance
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2069 #define GL_FOG_DISTANCE_MODE_NV 0x855A
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2070 #define GL_EYE_RADIAL_NV 0x855B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2071 #define GL_EYE_PLANE_ABSOLUTE_NV 0x855C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2072 /* reuse GL_EYE_PLANE */
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2073 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2074
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2075 #ifndef GL_NV_texgen_emboss
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2076 #define GL_EMBOSS_LIGHT_NV 0x855D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2077 #define GL_EMBOSS_CONSTANT_NV 0x855E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2078 #define GL_EMBOSS_MAP_NV 0x855F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2079 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2080
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2081 #ifndef GL_NV_blend_square
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2082 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2083
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2084 #ifndef GL_NV_texture_env_combine4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2085 #define GL_COMBINE4_NV 0x8503
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2086 #define GL_SOURCE3_RGB_NV 0x8583
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2087 #define GL_SOURCE3_ALPHA_NV 0x858B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2088 #define GL_OPERAND3_RGB_NV 0x8593
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2089 #define GL_OPERAND3_ALPHA_NV 0x859B
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2090 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2091
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2092 #ifndef GL_MESA_resize_buffers
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2093 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2094
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2095 #ifndef GL_MESA_window_pos
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2096 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2097
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2098 #ifndef GL_EXT_texture_compression_s3tc
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2099 #define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2100 #define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2101 #define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2102 #define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2103 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2104
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2105 #ifndef GL_IBM_cull_vertex
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2106 #define GL_CULL_VERTEX_IBM 103050
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2107 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2108
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2109 #ifndef GL_IBM_multimode_draw_arrays
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2110 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
2111
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2112 #ifndef GL_IBM_vertex_array_lists
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2113 #define GL_VERTEX_ARRAY_LIST_IBM 103070
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2114 #define GL_NORMAL_ARRAY_LIST_IBM 103071
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2115 #define GL_COLOR_ARRAY_LIST_IBM 103072
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2116 #define GL_INDEX_ARRAY_LIST_IBM 103073
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2117 #define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2118 #define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2119 #define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2120 #define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2121 #define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2122 #define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2123 #define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2124 #define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2125 #define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2126 #define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2127 #define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2128 #define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2129 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2130
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2131 #ifndef GL_SGIX_subsample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2132 #define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2133 #define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2134 #define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2135 #define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2136 #define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2137 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2138
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2139 #ifndef GL_SGIX_ycrcb_subsample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2140 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2141
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2142 #ifndef GL_SGIX_ycrcba
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2143 #define GL_YCRCB_SGIX 0x8318
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2144 #define GL_YCRCBA_SGIX 0x8319
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2145 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2146
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2147 #ifndef GL_SGI_depth_pass_instrument
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2148 #define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2149 #define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2150 #define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2151 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2152
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2153 #ifndef GL_3DFX_texture_compression_FXT1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2154 #define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2155 #define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2156 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2157
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2158 #ifndef GL_3DFX_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2159 #define GL_MULTISAMPLE_3DFX 0x86B2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2160 #define GL_SAMPLE_BUFFERS_3DFX 0x86B3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2161 #define GL_SAMPLES_3DFX 0x86B4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2162 #define GL_MULTISAMPLE_BIT_3DFX 0x20000000
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2163 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
2164
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2165 #ifndef GL_3DFX_tbuffer
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2166 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2167
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2168 #ifndef GL_EXT_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2169 #define GL_MULTISAMPLE_EXT 0x809D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2170 #define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2171 #define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2172 #define GL_SAMPLE_MASK_EXT 0x80A0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2173 #define GL_1PASS_EXT 0x80A1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2174 #define GL_2PASS_0_EXT 0x80A2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2175 #define GL_2PASS_1_EXT 0x80A3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2176 #define GL_4PASS_0_EXT 0x80A4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2177 #define GL_4PASS_1_EXT 0x80A5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2178 #define GL_4PASS_2_EXT 0x80A6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2179 #define GL_4PASS_3_EXT 0x80A7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2180 #define GL_SAMPLE_BUFFERS_EXT 0x80A8
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2181 #define GL_SAMPLES_EXT 0x80A9
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2182 #define GL_SAMPLE_MASK_VALUE_EXT 0x80AA
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2183 #define GL_SAMPLE_MASK_INVERT_EXT 0x80AB
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2184 #define GL_SAMPLE_PATTERN_EXT 0x80AC
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2185 #define GL_MULTISAMPLE_BIT_EXT 0x20000000
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2186 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2187
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2188 #ifndef GL_SGIX_vertex_preclip
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2189 #define GL_VERTEX_PRECLIP_SGIX 0x83EE
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2190 #define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2191 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2192
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2193 #ifndef GL_SGIX_convolution_accuracy
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2194 #define GL_CONVOLUTION_HINT_SGIX 0x8316
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2195 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2196
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2197 #ifndef GL_SGIX_resample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2198 #define GL_PACK_RESAMPLE_SGIX 0x842C
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2199 #define GL_UNPACK_RESAMPLE_SGIX 0x842D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2200 #define GL_RESAMPLE_REPLICATE_SGIX 0x842E
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2201 #define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2202 #define GL_RESAMPLE_DECIMATE_SGIX 0x8430
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2203 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2204
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2205 #ifndef GL_SGIS_point_line_texgen
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2206 #define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2207 #define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2208 #define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2209 #define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2210 #define GL_EYE_POINT_SGIS 0x81F4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2211 #define GL_OBJECT_POINT_SGIS 0x81F5
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2212 #define GL_EYE_LINE_SGIS 0x81F6
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2213 #define GL_OBJECT_LINE_SGIS 0x81F7
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2214 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2215
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2216 #ifndef GL_SGIS_texture_color_mask
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2217 #define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2218 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
2219
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2220 #ifndef GL_EXT_texture_env_dot3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2221 #define GL_DOT3_RGB_EXT 0x8740
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2222 #define GL_DOT3_RGBA_EXT 0x8741
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2223 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2224
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2225 #ifndef GL_ATI_texture_mirror_once
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2226 #define GL_MIRROR_CLAMP_ATI 0x8742
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2227 #define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2228 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2229
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2230 #ifndef GL_NV_fence
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2231 #define GL_ALL_COMPLETED_NV 0x84F2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2232 #define GL_FENCE_STATUS_NV 0x84F3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2233 #define GL_FENCE_CONDITION_NV 0x84F4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2234 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2235
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2236 #ifndef GL_IBM_texture_mirrored_repeat
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2237 #define GL_MIRRORED_REPEAT_IBM 0x8370
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2238 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2239
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2240 #ifndef GL_NV_evaluators
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2241 #define GL_EVAL_2D_NV 0x86C0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2242 #define GL_EVAL_TRIANGULAR_2D_NV 0x86C1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2243 #define GL_MAP_TESSELLATION_NV 0x86C2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2244 #define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2245 #define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2246 #define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2247 #define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2248 #define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2249 #define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2250 #define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2251 #define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2252 #define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2253 #define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2254 #define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2255 #define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2256 #define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2257 #define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2258 #define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2259 #define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2260 #define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2261 #define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2262 #define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2263 #define GL_MAX_MAP_TESSELLATION_NV 0x86D6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2264 #define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2265 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2266
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2267 #ifndef GL_NV_packed_depth_stencil
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2268 #define GL_DEPTH_STENCIL_NV 0x84F9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2269 #define GL_UNSIGNED_INT_24_8_NV 0x84FA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2270 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2271
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2272 #ifndef GL_NV_register_combiners2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2273 #define GL_PER_STAGE_CONSTANTS_NV 0x8535
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2274 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2275
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2276 #ifndef GL_NV_texture_compression_vtc
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2277 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2278
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2279 #ifndef GL_NV_texture_rectangle
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2280 #define GL_TEXTURE_RECTANGLE_NV 0x84F5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2281 #define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2282 #define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2283 #define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2284 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2285
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2286 #ifndef GL_NV_texture_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2287 #define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2288 #define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2289 #define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2290 #define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2291 #define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2292 #define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2293 #define GL_DSDT_MAG_INTENSITY_NV 0x86DC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2294 #define GL_SHADER_CONSISTENT_NV 0x86DD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2295 #define GL_TEXTURE_SHADER_NV 0x86DE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2296 #define GL_SHADER_OPERATION_NV 0x86DF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2297 #define GL_CULL_MODES_NV 0x86E0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2298 #define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2299 #define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2300 #define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2301 #define GL_OFFSET_TEXTURE_2D_MATRIX_NV GL_OFFSET_TEXTURE_MATRIX_NV
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2302 #define GL_OFFSET_TEXTURE_2D_SCALE_NV GL_OFFSET_TEXTURE_SCALE_NV
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2303 #define GL_OFFSET_TEXTURE_2D_BIAS_NV GL_OFFSET_TEXTURE_BIAS_NV
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2304 #define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2305 #define GL_CONST_EYE_NV 0x86E5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2306 #define GL_PASS_THROUGH_NV 0x86E6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2307 #define GL_CULL_FRAGMENT_NV 0x86E7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2308 #define GL_OFFSET_TEXTURE_2D_NV 0x86E8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2309 #define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2310 #define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2311 #define GL_DOT_PRODUCT_NV 0x86EC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2312 #define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2313 #define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2314 #define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2315 #define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2316 #define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2317 #define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2318 #define GL_HILO_NV 0x86F4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2319 #define GL_DSDT_NV 0x86F5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2320 #define GL_DSDT_MAG_NV 0x86F6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2321 #define GL_DSDT_MAG_VIB_NV 0x86F7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2322 #define GL_HILO16_NV 0x86F8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2323 #define GL_SIGNED_HILO_NV 0x86F9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2324 #define GL_SIGNED_HILO16_NV 0x86FA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2325 #define GL_SIGNED_RGBA_NV 0x86FB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2326 #define GL_SIGNED_RGBA8_NV 0x86FC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2327 #define GL_SIGNED_RGB_NV 0x86FE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2328 #define GL_SIGNED_RGB8_NV 0x86FF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2329 #define GL_SIGNED_LUMINANCE_NV 0x8701
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2330 #define GL_SIGNED_LUMINANCE8_NV 0x8702
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2331 #define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2332 #define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2333 #define GL_SIGNED_ALPHA_NV 0x8705
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2334 #define GL_SIGNED_ALPHA8_NV 0x8706
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2335 #define GL_SIGNED_INTENSITY_NV 0x8707
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2336 #define GL_SIGNED_INTENSITY8_NV 0x8708
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2337 #define GL_DSDT8_NV 0x8709
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2338 #define GL_DSDT8_MAG8_NV 0x870A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2339 #define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2340 #define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2341 #define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2342 #define GL_HI_SCALE_NV 0x870E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2343 #define GL_LO_SCALE_NV 0x870F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2344 #define GL_DS_SCALE_NV 0x8710
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2345 #define GL_DT_SCALE_NV 0x8711
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2346 #define GL_MAGNITUDE_SCALE_NV 0x8712
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2347 #define GL_VIBRANCE_SCALE_NV 0x8713
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2348 #define GL_HI_BIAS_NV 0x8714
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2349 #define GL_LO_BIAS_NV 0x8715
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2350 #define GL_DS_BIAS_NV 0x8716
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2351 #define GL_DT_BIAS_NV 0x8717
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2352 #define GL_MAGNITUDE_BIAS_NV 0x8718
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2353 #define GL_VIBRANCE_BIAS_NV 0x8719
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2354 #define GL_TEXTURE_BORDER_VALUES_NV 0x871A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2355 #define GL_TEXTURE_HI_SIZE_NV 0x871B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2356 #define GL_TEXTURE_LO_SIZE_NV 0x871C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2357 #define GL_TEXTURE_DS_SIZE_NV 0x871D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2358 #define GL_TEXTURE_DT_SIZE_NV 0x871E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2359 #define GL_TEXTURE_MAG_SIZE_NV 0x871F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2360 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2361
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2362 #ifndef GL_NV_texture_shader2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2363 #define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2364 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2365
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2366 #ifndef GL_NV_vertex_array_range2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2367 #define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2368 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2369
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2370 #ifndef GL_NV_vertex_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2371 #define GL_VERTEX_PROGRAM_NV 0x8620
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2372 #define GL_VERTEX_STATE_PROGRAM_NV 0x8621
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2373 #define GL_ATTRIB_ARRAY_SIZE_NV 0x8623
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2374 #define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2375 #define GL_ATTRIB_ARRAY_TYPE_NV 0x8625
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2376 #define GL_CURRENT_ATTRIB_NV 0x8626
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2377 #define GL_PROGRAM_LENGTH_NV 0x8627
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2378 #define GL_PROGRAM_STRING_NV 0x8628
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2379 #define GL_MODELVIEW_PROJECTION_NV 0x8629
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2380 #define GL_IDENTITY_NV 0x862A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2381 #define GL_INVERSE_NV 0x862B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2382 #define GL_TRANSPOSE_NV 0x862C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2383 #define GL_INVERSE_TRANSPOSE_NV 0x862D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2384 #define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2385 #define GL_MAX_TRACK_MATRICES_NV 0x862F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2386 #define GL_MATRIX0_NV 0x8630
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2387 #define GL_MATRIX1_NV 0x8631
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2388 #define GL_MATRIX2_NV 0x8632
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2389 #define GL_MATRIX3_NV 0x8633
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2390 #define GL_MATRIX4_NV 0x8634
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2391 #define GL_MATRIX5_NV 0x8635
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2392 #define GL_MATRIX6_NV 0x8636
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2393 #define GL_MATRIX7_NV 0x8637
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2394 #define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2395 #define GL_CURRENT_MATRIX_NV 0x8641
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2396 #define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2397 #define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2398 #define GL_PROGRAM_PARAMETER_NV 0x8644
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2399 #define GL_ATTRIB_ARRAY_POINTER_NV 0x8645
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2400 #define GL_PROGRAM_TARGET_NV 0x8646
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2401 #define GL_PROGRAM_RESIDENT_NV 0x8647
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2402 #define GL_TRACK_MATRIX_NV 0x8648
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2403 #define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2404 #define GL_VERTEX_PROGRAM_BINDING_NV 0x864A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2405 #define GL_PROGRAM_ERROR_POSITION_NV 0x864B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2406 #define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2407 #define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2408 #define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2409 #define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2410 #define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2411 #define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2412 #define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2413 #define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2414 #define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2415 #define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2416 #define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2417 #define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2418 #define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2419 #define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2420 #define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2421 #define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2422 #define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2423 #define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2424 #define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2425 #define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2426 #define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2427 #define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2428 #define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2429 #define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2430 #define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2431 #define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2432 #define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2433 #define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2434 #define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2435 #define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2436 #define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2437 #define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2438 #define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2439 #define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2440 #define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2441 #define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2442 #define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2443 #define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2444 #define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2445 #define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2446 #define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2447 #define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2448 #define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2449 #define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2450 #define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2451 #define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2452 #define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2453 #define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2454 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2455
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2456 #ifndef GL_SGIX_texture_coordinate_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2457 #define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2458 #define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2459 #define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2460 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2461
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2462 #ifndef GL_SGIX_scalebias_hint
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2463 #define GL_SCALEBIAS_HINT_SGIX 0x8322
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2464 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2465
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2466 #ifndef GL_OML_interlace
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2467 #define GL_INTERLACE_OML 0x8980
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2468 #define GL_INTERLACE_READ_OML 0x8981
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2469 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2470
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2471 #ifndef GL_OML_subsample
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2472 #define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2473 #define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2474 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2475
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2476 #ifndef GL_OML_resample
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2477 #define GL_PACK_RESAMPLE_OML 0x8984
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2478 #define GL_UNPACK_RESAMPLE_OML 0x8985
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2479 #define GL_RESAMPLE_REPLICATE_OML 0x8986
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2480 #define GL_RESAMPLE_ZERO_FILL_OML 0x8987
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2481 #define GL_RESAMPLE_AVERAGE_OML 0x8988
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2482 #define GL_RESAMPLE_DECIMATE_OML 0x8989
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2483 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2484
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2485 #ifndef GL_NV_copy_depth_to_color
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2486 #define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2487 #define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2488 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2489
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2490 #ifndef GL_ATI_envmap_bumpmap
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2491 #define GL_BUMP_ROT_MATRIX_ATI 0x8775
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2492 #define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2493 #define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2494 #define GL_BUMP_TEX_UNITS_ATI 0x8778
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2495 #define GL_DUDV_ATI 0x8779
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2496 #define GL_DU8DV8_ATI 0x877A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2497 #define GL_BUMP_ENVMAP_ATI 0x877B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2498 #define GL_BUMP_TARGET_ATI 0x877C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2499 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2500
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2501 #ifndef GL_ATI_fragment_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2502 #define GL_FRAGMENT_SHADER_ATI 0x8920
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2503 #define GL_REG_0_ATI 0x8921
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2504 #define GL_REG_1_ATI 0x8922
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2505 #define GL_REG_2_ATI 0x8923
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2506 #define GL_REG_3_ATI 0x8924
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2507 #define GL_REG_4_ATI 0x8925
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2508 #define GL_REG_5_ATI 0x8926
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2509 #define GL_REG_6_ATI 0x8927
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2510 #define GL_REG_7_ATI 0x8928
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2511 #define GL_REG_8_ATI 0x8929
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2512 #define GL_REG_9_ATI 0x892A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2513 #define GL_REG_10_ATI 0x892B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2514 #define GL_REG_11_ATI 0x892C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2515 #define GL_REG_12_ATI 0x892D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2516 #define GL_REG_13_ATI 0x892E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2517 #define GL_REG_14_ATI 0x892F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2518 #define GL_REG_15_ATI 0x8930
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2519 #define GL_REG_16_ATI 0x8931
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2520 #define GL_REG_17_ATI 0x8932
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2521 #define GL_REG_18_ATI 0x8933
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2522 #define GL_REG_19_ATI 0x8934
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2523 #define GL_REG_20_ATI 0x8935
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2524 #define GL_REG_21_ATI 0x8936
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2525 #define GL_REG_22_ATI 0x8937
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2526 #define GL_REG_23_ATI 0x8938
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2527 #define GL_REG_24_ATI 0x8939
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2528 #define GL_REG_25_ATI 0x893A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2529 #define GL_REG_26_ATI 0x893B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2530 #define GL_REG_27_ATI 0x893C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2531 #define GL_REG_28_ATI 0x893D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2532 #define GL_REG_29_ATI 0x893E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2533 #define GL_REG_30_ATI 0x893F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2534 #define GL_REG_31_ATI 0x8940
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2535 #define GL_CON_0_ATI 0x8941
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2536 #define GL_CON_1_ATI 0x8942
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2537 #define GL_CON_2_ATI 0x8943
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2538 #define GL_CON_3_ATI 0x8944
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2539 #define GL_CON_4_ATI 0x8945
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2540 #define GL_CON_5_ATI 0x8946
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2541 #define GL_CON_6_ATI 0x8947
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2542 #define GL_CON_7_ATI 0x8948
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2543 #define GL_CON_8_ATI 0x8949
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2544 #define GL_CON_9_ATI 0x894A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2545 #define GL_CON_10_ATI 0x894B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2546 #define GL_CON_11_ATI 0x894C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2547 #define GL_CON_12_ATI 0x894D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2548 #define GL_CON_13_ATI 0x894E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2549 #define GL_CON_14_ATI 0x894F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2550 #define GL_CON_15_ATI 0x8950
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2551 #define GL_CON_16_ATI 0x8951
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2552 #define GL_CON_17_ATI 0x8952
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2553 #define GL_CON_18_ATI 0x8953
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2554 #define GL_CON_19_ATI 0x8954
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2555 #define GL_CON_20_ATI 0x8955
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2556 #define GL_CON_21_ATI 0x8956
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2557 #define GL_CON_22_ATI 0x8957
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2558 #define GL_CON_23_ATI 0x8958
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2559 #define GL_CON_24_ATI 0x8959
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2560 #define GL_CON_25_ATI 0x895A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2561 #define GL_CON_26_ATI 0x895B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2562 #define GL_CON_27_ATI 0x895C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2563 #define GL_CON_28_ATI 0x895D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2564 #define GL_CON_29_ATI 0x895E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2565 #define GL_CON_30_ATI 0x895F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2566 #define GL_CON_31_ATI 0x8960
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2567 #define GL_MOV_ATI 0x8961
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2568 #define GL_ADD_ATI 0x8963
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2569 #define GL_MUL_ATI 0x8964
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2570 #define GL_SUB_ATI 0x8965
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2571 #define GL_DOT3_ATI 0x8966
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2572 #define GL_DOT4_ATI 0x8967
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2573 #define GL_MAD_ATI 0x8968
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2574 #define GL_LERP_ATI 0x8969
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2575 #define GL_CND_ATI 0x896A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2576 #define GL_CND0_ATI 0x896B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2577 #define GL_DOT2_ADD_ATI 0x896C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2578 #define GL_SECONDARY_INTERPOLATOR_ATI 0x896D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2579 #define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2580 #define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2581 #define GL_NUM_PASSES_ATI 0x8970
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2582 #define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2583 #define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2584 #define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2585 #define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2586 #define GL_COLOR_ALPHA_PAIRING_ATI 0x8975
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2587 #define GL_SWIZZLE_STR_ATI 0x8976
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2588 #define GL_SWIZZLE_STQ_ATI 0x8977
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2589 #define GL_SWIZZLE_STR_DR_ATI 0x8978
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2590 #define GL_SWIZZLE_STQ_DQ_ATI 0x8979
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2591 #define GL_SWIZZLE_STRQ_ATI 0x897A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2592 #define GL_SWIZZLE_STRQ_DQ_ATI 0x897B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2593 #define GL_RED_BIT_ATI 0x00000001
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2594 #define GL_GREEN_BIT_ATI 0x00000002
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2595 #define GL_BLUE_BIT_ATI 0x00000004
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2596 #define GL_2X_BIT_ATI 0x00000001
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2597 #define GL_4X_BIT_ATI 0x00000002
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2598 #define GL_8X_BIT_ATI 0x00000004
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2599 #define GL_HALF_BIT_ATI 0x00000008
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2600 #define GL_QUARTER_BIT_ATI 0x00000010
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2601 #define GL_EIGHTH_BIT_ATI 0x00000020
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2602 #define GL_SATURATE_BIT_ATI 0x00000040
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2603 #define GL_COMP_BIT_ATI 0x00000002
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2604 #define GL_NEGATE_BIT_ATI 0x00000004
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2605 #define GL_BIAS_BIT_ATI 0x00000008
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2606 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2607
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2608 #ifndef GL_ATI_pn_triangles
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2609 #define GL_PN_TRIANGLES_ATI 0x87F0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2610 #define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2611 #define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2612 #define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2613 #define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2614 #define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2615 #define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2616 #define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2617 #define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2618 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2619
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2620 #ifndef GL_ATI_vertex_array_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2621 #define GL_STATIC_ATI 0x8760
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2622 #define GL_DYNAMIC_ATI 0x8761
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2623 #define GL_PRESERVE_ATI 0x8762
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2624 #define GL_DISCARD_ATI 0x8763
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2625 #define GL_OBJECT_BUFFER_SIZE_ATI 0x8764
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2626 #define GL_OBJECT_BUFFER_USAGE_ATI 0x8765
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2627 #define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2628 #define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2629 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2630
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2631 #ifndef GL_EXT_vertex_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2632 #define GL_VERTEX_SHADER_EXT 0x8780
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2633 #define GL_VERTEX_SHADER_BINDING_EXT 0x8781
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2634 #define GL_OP_INDEX_EXT 0x8782
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2635 #define GL_OP_NEGATE_EXT 0x8783
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2636 #define GL_OP_DOT3_EXT 0x8784
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2637 #define GL_OP_DOT4_EXT 0x8785
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2638 #define GL_OP_MUL_EXT 0x8786
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2639 #define GL_OP_ADD_EXT 0x8787
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2640 #define GL_OP_MADD_EXT 0x8788
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2641 #define GL_OP_FRAC_EXT 0x8789
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2642 #define GL_OP_MAX_EXT 0x878A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2643 #define GL_OP_MIN_EXT 0x878B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2644 #define GL_OP_SET_GE_EXT 0x878C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2645 #define GL_OP_SET_LT_EXT 0x878D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2646 #define GL_OP_CLAMP_EXT 0x878E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2647 #define GL_OP_FLOOR_EXT 0x878F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2648 #define GL_OP_ROUND_EXT 0x8790
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2649 #define GL_OP_EXP_BASE_2_EXT 0x8791
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2650 #define GL_OP_LOG_BASE_2_EXT 0x8792
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2651 #define GL_OP_POWER_EXT 0x8793
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2652 #define GL_OP_RECIP_EXT 0x8794
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2653 #define GL_OP_RECIP_SQRT_EXT 0x8795
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2654 #define GL_OP_SUB_EXT 0x8796
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2655 #define GL_OP_CROSS_PRODUCT_EXT 0x8797
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2656 #define GL_OP_MULTIPLY_MATRIX_EXT 0x8798
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2657 #define GL_OP_MOV_EXT 0x8799
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2658 #define GL_OUTPUT_VERTEX_EXT 0x879A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2659 #define GL_OUTPUT_COLOR0_EXT 0x879B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2660 #define GL_OUTPUT_COLOR1_EXT 0x879C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2661 #define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2662 #define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2663 #define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2664 #define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2665 #define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2666 #define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2667 #define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2668 #define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2669 #define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2670 #define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2671 #define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2672 #define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2673 #define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2674 #define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2675 #define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2676 #define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2677 #define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2678 #define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2679 #define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2680 #define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2681 #define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2682 #define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2683 #define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2684 #define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2685 #define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2686 #define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2687 #define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2688 #define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2689 #define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2690 #define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2691 #define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2692 #define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2693 #define GL_OUTPUT_FOG_EXT 0x87BD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2694 #define GL_SCALAR_EXT 0x87BE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2695 #define GL_VECTOR_EXT 0x87BF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2696 #define GL_MATRIX_EXT 0x87C0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2697 #define GL_VARIANT_EXT 0x87C1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2698 #define GL_INVARIANT_EXT 0x87C2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2699 #define GL_LOCAL_CONSTANT_EXT 0x87C3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2700 #define GL_LOCAL_EXT 0x87C4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2701 #define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2702 #define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2703 #define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2704 #define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2705 #define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2706 #define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2707 #define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2708 #define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2709 #define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2710 #define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2711 #define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2712 #define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2713 #define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2714 #define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2715 #define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2716 #define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2717 #define GL_X_EXT 0x87D5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2718 #define GL_Y_EXT 0x87D6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2719 #define GL_Z_EXT 0x87D7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2720 #define GL_W_EXT 0x87D8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2721 #define GL_NEGATIVE_X_EXT 0x87D9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2722 #define GL_NEGATIVE_Y_EXT 0x87DA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2723 #define GL_NEGATIVE_Z_EXT 0x87DB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2724 #define GL_NEGATIVE_W_EXT 0x87DC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2725 #define GL_ZERO_EXT 0x87DD
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2726 #define GL_ONE_EXT 0x87DE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2727 #define GL_NEGATIVE_ONE_EXT 0x87DF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2728 #define GL_NORMALIZED_RANGE_EXT 0x87E0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2729 #define GL_FULL_RANGE_EXT 0x87E1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2730 #define GL_CURRENT_VERTEX_EXT 0x87E2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2731 #define GL_MVP_MATRIX_EXT 0x87E3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2732 #define GL_VARIANT_VALUE_EXT 0x87E4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2733 #define GL_VARIANT_DATATYPE_EXT 0x87E5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2734 #define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2735 #define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2736 #define GL_VARIANT_ARRAY_EXT 0x87E8
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2737 #define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2738 #define GL_INVARIANT_VALUE_EXT 0x87EA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2739 #define GL_INVARIANT_DATATYPE_EXT 0x87EB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2740 #define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2741 #define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2742 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2743
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2744 #ifndef GL_ATI_vertex_streams
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2745 #define GL_MAX_VERTEX_STREAMS_ATI 0x876B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2746 #define GL_VERTEX_STREAM0_ATI 0x876C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2747 #define GL_VERTEX_STREAM1_ATI 0x876D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2748 #define GL_VERTEX_STREAM2_ATI 0x876E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2749 #define GL_VERTEX_STREAM3_ATI 0x876F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2750 #define GL_VERTEX_STREAM4_ATI 0x8770
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2751 #define GL_VERTEX_STREAM5_ATI 0x8771
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2752 #define GL_VERTEX_STREAM6_ATI 0x8772
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2753 #define GL_VERTEX_STREAM7_ATI 0x8773
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2754 #define GL_VERTEX_SOURCE_ATI 0x8774
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2755 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2756
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2757 #ifndef GL_ATI_element_array
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2758 #define GL_ELEMENT_ARRAY_ATI 0x8768
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2759 #define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2760 #define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2761 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2762
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2763 #ifndef GL_SUN_mesh_array
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2764 #define GL_QUAD_MESH_SUN 0x8614
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2765 #define GL_TRIANGLE_MESH_SUN 0x8615
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2766 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2767
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2768 #ifndef GL_SUN_slice_accum
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2769 #define GL_SLICE_ACCUM_SUN 0x85CC
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2770 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2771
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2772 #ifndef GL_NV_multisample_filter_hint
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2773 #define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2774 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2775
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2776 #ifndef GL_NV_depth_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2777 #define GL_DEPTH_CLAMP_NV 0x864F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2778 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2779
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2780 #ifndef GL_NV_occlusion_query
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2781 #define GL_PIXEL_COUNTER_BITS_NV 0x8864
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2782 #define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2783 #define GL_PIXEL_COUNT_NV 0x8866
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2784 #define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2785 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2786
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2787 #ifndef GL_NV_point_sprite
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2788 #define GL_POINT_SPRITE_NV 0x8861
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2789 #define GL_COORD_REPLACE_NV 0x8862
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2790 #define GL_POINT_SPRITE_R_MODE_NV 0x8863
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2791 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2792
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2793 #ifndef GL_NV_texture_shader3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2794 #define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2795 #define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2796 #define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2797 #define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2798 #define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2799 #define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2800 #define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2801 #define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2802 #define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2803 #define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2804 #define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2805 #define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2806 #define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2807 #define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2808 #define GL_HILO8_NV 0x885E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2809 #define GL_SIGNED_HILO8_NV 0x885F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2810 #define GL_FORCE_BLUE_TO_ONE_NV 0x8860
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2811 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2812
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2813 #ifndef GL_NV_vertex_program1_1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2814 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2815
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2816 #ifndef GL_EXT_shadow_funcs
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2817 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2818
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2819 #ifndef GL_EXT_stencil_two_side
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2820 #define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2821 #define GL_ACTIVE_STENCIL_FACE_EXT 0x8911
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2822 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2823
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2824 #ifndef GL_ATI_text_fragment_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2825 #define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2826 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2827
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2828 #ifndef GL_APPLE_client_storage
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2829 #define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2830 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2831
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2832 #ifndef GL_APPLE_element_array
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2833 #define GL_ELEMENT_ARRAY_APPLE 0x8768
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2834 #define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8769
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2835 #define GL_ELEMENT_ARRAY_POINTER_APPLE 0x876A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2836 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2837
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2838 #ifndef GL_APPLE_fence
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2839 #define GL_DRAW_PIXELS_APPLE 0x8A0A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2840 #define GL_FENCE_APPLE 0x8A0B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2841 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2842
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2843 #ifndef GL_APPLE_vertex_array_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2844 #define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2845 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2846
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2847 #ifndef GL_APPLE_vertex_array_range
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2848 #define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2849 #define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2850 #define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2851 #define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2852 #define GL_STORAGE_CACHED_APPLE 0x85BE
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2853 #define GL_STORAGE_SHARED_APPLE 0x85BF
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2854 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2855
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2856 #ifndef GL_APPLE_ycbcr_422
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2857 #define GL_YCBCR_422_APPLE 0x85B9
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2858 #define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2859 #define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2860 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2861
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2862 #ifndef GL_S3_s3tc
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2863 #define GL_RGB_S3TC 0x83A0
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2864 #define GL_RGB4_S3TC 0x83A1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2865 #define GL_RGBA_S3TC 0x83A2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2866 #define GL_RGBA4_S3TC 0x83A3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2867 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2868
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2869 #ifndef GL_ATI_draw_buffers
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2870 #define GL_MAX_DRAW_BUFFERS_ATI 0x8824
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2871 #define GL_DRAW_BUFFER0_ATI 0x8825
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2872 #define GL_DRAW_BUFFER1_ATI 0x8826
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2873 #define GL_DRAW_BUFFER2_ATI 0x8827
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2874 #define GL_DRAW_BUFFER3_ATI 0x8828
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2875 #define GL_DRAW_BUFFER4_ATI 0x8829
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2876 #define GL_DRAW_BUFFER5_ATI 0x882A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2877 #define GL_DRAW_BUFFER6_ATI 0x882B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2878 #define GL_DRAW_BUFFER7_ATI 0x882C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2879 #define GL_DRAW_BUFFER8_ATI 0x882D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2880 #define GL_DRAW_BUFFER9_ATI 0x882E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2881 #define GL_DRAW_BUFFER10_ATI 0x882F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2882 #define GL_DRAW_BUFFER11_ATI 0x8830
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2883 #define GL_DRAW_BUFFER12_ATI 0x8831
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2884 #define GL_DRAW_BUFFER13_ATI 0x8832
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2885 #define GL_DRAW_BUFFER14_ATI 0x8833
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2886 #define GL_DRAW_BUFFER15_ATI 0x8834
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2887 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2888
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2889 #ifndef GL_ATI_pixel_format_float
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2890 #define GL_TYPE_RGBA_FLOAT_ATI 0x8820
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2891 #define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2892 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2893
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2894 #ifndef GL_ATI_texture_env_combine3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2895 #define GL_MODULATE_ADD_ATI 0x8744
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2896 #define GL_MODULATE_SIGNED_ADD_ATI 0x8745
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2897 #define GL_MODULATE_SUBTRACT_ATI 0x8746
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2898 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2899
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2900 #ifndef GL_ATI_texture_float
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2901 #define GL_RGBA_FLOAT32_ATI 0x8814
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2902 #define GL_RGB_FLOAT32_ATI 0x8815
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2903 #define GL_ALPHA_FLOAT32_ATI 0x8816
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2904 #define GL_INTENSITY_FLOAT32_ATI 0x8817
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2905 #define GL_LUMINANCE_FLOAT32_ATI 0x8818
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2906 #define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2907 #define GL_RGBA_FLOAT16_ATI 0x881A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2908 #define GL_RGB_FLOAT16_ATI 0x881B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2909 #define GL_ALPHA_FLOAT16_ATI 0x881C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2910 #define GL_INTENSITY_FLOAT16_ATI 0x881D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2911 #define GL_LUMINANCE_FLOAT16_ATI 0x881E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2912 #define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2913 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2914
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2915 #ifndef GL_NV_float_buffer
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2916 #define GL_FLOAT_R_NV 0x8880
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2917 #define GL_FLOAT_RG_NV 0x8881
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2918 #define GL_FLOAT_RGB_NV 0x8882
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2919 #define GL_FLOAT_RGBA_NV 0x8883
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2920 #define GL_FLOAT_R16_NV 0x8884
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2921 #define GL_FLOAT_R32_NV 0x8885
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2922 #define GL_FLOAT_RG16_NV 0x8886
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2923 #define GL_FLOAT_RG32_NV 0x8887
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2924 #define GL_FLOAT_RGB16_NV 0x8888
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2925 #define GL_FLOAT_RGB32_NV 0x8889
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2926 #define GL_FLOAT_RGBA16_NV 0x888A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2927 #define GL_FLOAT_RGBA32_NV 0x888B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2928 #define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2929 #define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2930 #define GL_FLOAT_RGBA_MODE_NV 0x888E
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2931 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2932
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2933 #ifndef GL_NV_fragment_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2934 #define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2935 #define GL_FRAGMENT_PROGRAM_NV 0x8870
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2936 #define GL_MAX_TEXTURE_COORDS_NV 0x8871
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2937 #define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2938 #define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2939 #define GL_PROGRAM_ERROR_STRING_NV 0x8874
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2940 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2941
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2942 #ifndef GL_NV_half_float
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2943 #define GL_HALF_FLOAT_NV 0x140B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2944 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2945
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2946 #ifndef GL_NV_pixel_data_range
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2947 #define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2948 #define GL_READ_PIXEL_DATA_RANGE_NV 0x8879
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2949 #define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2950 #define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2951 #define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2952 #define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2953 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2954
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2955 #ifndef GL_NV_primitive_restart
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2956 #define GL_PRIMITIVE_RESTART_NV 0x8558
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2957 #define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2958 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2959
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2960 #ifndef GL_NV_texture_expand_normal
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2961 #define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2962 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2963
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2964 #ifndef GL_NV_vertex_program2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2965 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2966
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2967 #ifndef GL_ATI_map_object_buffer
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2968 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2969
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2970 #ifndef GL_ATI_separate_stencil
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2971 #define GL_STENCIL_BACK_FUNC_ATI 0x8800
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2972 #define GL_STENCIL_BACK_FAIL_ATI 0x8801
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2973 #define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2974 #define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2975 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2976
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2977 #ifndef GL_ATI_vertex_attrib_array_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2978 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2979
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2980 #ifndef GL_OES_read_format
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2981 #define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2982 #define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2983 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
2984
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2985 #ifndef GL_EXT_depth_bounds_test
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2986 #define GL_DEPTH_BOUNDS_TEST_EXT 0x8890
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2987 #define GL_DEPTH_BOUNDS_EXT 0x8891
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2988 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2989
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2990 #ifndef GL_EXT_texture_mirror_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2991 #define GL_MIRROR_CLAMP_EXT 0x8742
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2992 #define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2993 #define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2994 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2995
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2996 #ifndef GL_EXT_blend_equation_separate
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2997 #define GL_BLEND_EQUATION_RGB_EXT GL_BLEND_EQUATION
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2998 #define GL_BLEND_EQUATION_ALPHA_EXT 0x883D
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
2999 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3000
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3001 #ifndef GL_MESA_pack_invert
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3002 #define GL_PACK_INVERT_MESA 0x8758
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3003 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3004
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3005 #ifndef GL_MESA_ycbcr_texture
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3006 #define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3007 #define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3008 #define GL_YCBCR_MESA 0x8757
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3009 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3010
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3011 #ifndef GL_EXT_pixel_buffer_object
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3012 #define GL_PIXEL_PACK_BUFFER_EXT 0x88EB
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3013 #define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3014 #define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3015 #define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3016 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3017
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3018 #ifndef GL_NV_fragment_program_option
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3019 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3020
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3021 #ifndef GL_NV_fragment_program2
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3022 #define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3023 #define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3024 #define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3025 #define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3026 #define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3027 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3028
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3029 #ifndef GL_NV_vertex_program2_option
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3030 /* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3031 /* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3032 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3033
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3034 #ifndef GL_NV_vertex_program3
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3035 /* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3036 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3037
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3038 #ifndef GL_EXT_framebuffer_object
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3039 #define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3040 #define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3041 #define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3042 #define GL_RENDERBUFFER_BINDING_EXT 0x8CA7
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3043 #define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3044 #define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3045 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3046 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3047 #define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3048 #define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3049 #define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3050 #define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3051 #define GL_FRAMEBUFFER_INCOMPLETE_DUPLICATE_ATTACHMENT_EXT 0x8CD8
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3052 #define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3053 #define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3054 #define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3055 #define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3056 #define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3057 #define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3058 #define GL_COLOR_ATTACHMENT0_EXT 0x8CE0
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3059 #define GL_COLOR_ATTACHMENT1_EXT 0x8CE1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3060 #define GL_COLOR_ATTACHMENT2_EXT 0x8CE2
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3061 #define GL_COLOR_ATTACHMENT3_EXT 0x8CE3
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3062 #define GL_COLOR_ATTACHMENT4_EXT 0x8CE4
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3063 #define GL_COLOR_ATTACHMENT5_EXT 0x8CE5
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3064 #define GL_COLOR_ATTACHMENT6_EXT 0x8CE6
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3065 #define GL_COLOR_ATTACHMENT7_EXT 0x8CE7
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3066 #define GL_COLOR_ATTACHMENT8_EXT 0x8CE8
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3067 #define GL_COLOR_ATTACHMENT9_EXT 0x8CE9
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3068 #define GL_COLOR_ATTACHMENT10_EXT 0x8CEA
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3069 #define GL_COLOR_ATTACHMENT11_EXT 0x8CEB
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3070 #define GL_COLOR_ATTACHMENT12_EXT 0x8CEC
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3071 #define GL_COLOR_ATTACHMENT13_EXT 0x8CED
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3072 #define GL_COLOR_ATTACHMENT14_EXT 0x8CEE
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3073 #define GL_COLOR_ATTACHMENT15_EXT 0x8CEF
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3074 #define GL_DEPTH_ATTACHMENT_EXT 0x8D00
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3075 #define GL_STENCIL_ATTACHMENT_EXT 0x8D20
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3076 #define GL_FRAMEBUFFER_EXT 0x8D40
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3077 #define GL_RENDERBUFFER_EXT 0x8D41
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3078 #define GL_RENDERBUFFER_WIDTH_EXT 0x8D42
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3079 #define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3080 #define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3081 #define GL_STENCIL_INDEX1_EXT 0x8D46
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3082 #define GL_STENCIL_INDEX4_EXT 0x8D47
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3083 #define GL_STENCIL_INDEX8_EXT 0x8D48
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3084 #define GL_STENCIL_INDEX16_EXT 0x8D49
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3085 #define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3086 #define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3087 #define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3088 #define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3089 #define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3090 #define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3091 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3092
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3093 #ifndef GL_GREMEDY_string_marker
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3094 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3095
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
3096
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
3097 /*************************************************************/
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
3098
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3099 #include <stddef.h>
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3100 #ifndef GL_VERSION_2_0
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3101 /* GL type for program/shader text */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3102 typedef char GLchar; /* native character */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3103 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3104
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3105 #ifndef GL_VERSION_1_5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3106 /* GL types for handling large vertex buffer objects */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3107 typedef ptrdiff_t GLintptr;
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3108 typedef ptrdiff_t GLsizeiptr;
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3109 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3110
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3111 #ifndef GL_ARB_vertex_buffer_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3112 /* GL types for handling large vertex buffer objects */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3113 typedef ptrdiff_t GLintptrARB;
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3114 typedef ptrdiff_t GLsizeiptrARB;
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3115 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3116
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3117 #ifndef GL_ARB_shader_objects
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3118 /* GL types for handling shader object handles and program/shader text */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3119 typedef char GLcharARB; /* native character */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3120 typedef unsigned int GLhandleARB; /* shader object handle */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3121 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3122
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3123 /* GL types for "half" precision (s10e5) float data in host memory */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3124 #ifndef GL_ARB_half_float_pixel
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3125 typedef unsigned short GLhalfARB;
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3126 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3127
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3128 #ifndef GL_NV_half_float
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3129 typedef unsigned short GLhalfNV;
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3130 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3131
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3132 #ifndef GL_VERSION_1_2
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3133 #define GL_VERSION_1_2 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3134 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3135 GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3136 GLAPI void APIENTRY glBlendEquation (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3137 GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3138 GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3139 GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3140 GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3141 GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3142 GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3143 GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3144 GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3145 GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3146 GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3147 GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3148 GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3149 GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3150 GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3151 GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3152 GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3153 GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3154 GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3155 GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3156 GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3157 GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3158 GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3159 GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3160 GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3161 GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3162 GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3163 GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3164 GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3165 GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3166 GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3167 GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3168 GLAPI void APIENTRY glResetHistogram (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3169 GLAPI void APIENTRY glResetMinmax (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3170 GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3171 GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3172 GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3173 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3174 typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3175 typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3176 typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3177 typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3178 typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3179 typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3180 typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3181 typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3182 typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3183 typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3184 typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3185 typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3186 typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3187 typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3188 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3189 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3190 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3191 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3192 typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3193 typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3194 typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3195 typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3196 typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3197 typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3198 typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3199 typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3200 typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3201 typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3202 typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3203 typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3204 typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3205 typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3206 typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3207 typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3208 typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3209 typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3210 typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3211 typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3212 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3213
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3214 #ifndef GL_VERSION_1_3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3215 #define GL_VERSION_1_3 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3216 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3217 GLAPI void APIENTRY glActiveTexture (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3218 GLAPI void APIENTRY glClientActiveTexture (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3219 GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3220 GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3221 GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3222 GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3223 GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3224 GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3225 GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3226 GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3227 GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3228 GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3229 GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3230 GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3231 GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3232 GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3233 GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3234 GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3235 GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3236 GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3237 GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3238 GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3239 GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3240 GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3241 GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3242 GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3243 GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3244 GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3245 GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3246 GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3247 GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3248 GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3249 GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3250 GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3251 GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3252 GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3253 GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3254 GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3255 GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3256 GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3257 GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3258 GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3259 GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3260 GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3261 GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3262 GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3263 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3264 typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3265 typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3266 typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3267 typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3268 typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3269 typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3270 typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3271 typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3272 typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3273 typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3274 typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3275 typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3276 typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3277 typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3278 typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3279 typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3280 typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3281 typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3282 typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3283 typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3284 typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3285 typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3286 typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3287 typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3288 typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3289 typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3290 typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3291 typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3292 typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3293 typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3294 typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3295 typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3296 typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3297 typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3298 typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3299 typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3300 typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3301 typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3302 typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3303 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3304 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3305 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3306 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3307 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3308 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3309 typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3310 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3311
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3312 #ifndef GL_VERSION_1_4
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3313 #define GL_VERSION_1_4 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3314 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3315 GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3316 GLAPI void APIENTRY glFogCoordf (GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3317 GLAPI void APIENTRY glFogCoordfv (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3318 GLAPI void APIENTRY glFogCoordd (GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3319 GLAPI void APIENTRY glFogCoorddv (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3320 GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3321 GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3322 GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3323 GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3324 GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3325 GLAPI void APIENTRY glPointParameteri (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3326 GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3327 GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3328 GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3329 GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3330 GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3331 GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3332 GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3333 GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3334 GLAPI void APIENTRY glSecondaryColor3iv (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3335 GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3336 GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3337 GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3338 GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3339 GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3340 GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3341 GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3342 GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3343 GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3344 GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3345 GLAPI void APIENTRY glWindowPos2dv (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3346 GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3347 GLAPI void APIENTRY glWindowPos2fv (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3348 GLAPI void APIENTRY glWindowPos2i (GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3349 GLAPI void APIENTRY glWindowPos2iv (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3350 GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3351 GLAPI void APIENTRY glWindowPos2sv (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3352 GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3353 GLAPI void APIENTRY glWindowPos3dv (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3354 GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3355 GLAPI void APIENTRY glWindowPos3fv (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3356 GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3357 GLAPI void APIENTRY glWindowPos3iv (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3358 GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3359 GLAPI void APIENTRY glWindowPos3sv (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3360 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3361 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3362 typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3363 typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3364 typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3365 typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3366 typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3367 typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3368 typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3369 typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3370 typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3371 typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3372 typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3373 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3374 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3375 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3376 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3377 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3378 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3379 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3380 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3381 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3382 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3383 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3384 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3385 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3386 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3387 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3388 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3389 typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3390 typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3391 typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3392 typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3393 typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3394 typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3395 typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3396 typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3397 typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3398 typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3399 typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3400 typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3401 typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3402 typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3403 typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3404 typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3405 typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3406 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3407
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3408 #ifndef GL_VERSION_1_5
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3409 #define GL_VERSION_1_5 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3410 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3411 GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3412 GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3413 GLAPI GLboolean APIENTRY glIsQuery (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3414 GLAPI void APIENTRY glBeginQuery (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3415 GLAPI void APIENTRY glEndQuery (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3416 GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3417 GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3418 GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3419 GLAPI void APIENTRY glBindBuffer (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3420 GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3421 GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3422 GLAPI GLboolean APIENTRY glIsBuffer (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3423 GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3424 GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3425 GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3426 GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3427 GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3428 GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3429 GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3430 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3431 typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3432 typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3433 typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3434 typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3435 typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3436 typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3437 typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3438 typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3439 typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3440 typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3441 typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3442 typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3443 typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3444 typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3445 typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3446 typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3447 typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3448 typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3449 typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3450 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
3451
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3452 #ifndef GL_VERSION_2_0
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3453 #define GL_VERSION_2_0 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3454 #ifdef GL_GLEXT_PROTOTYPES
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3455 GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3456 GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3457 GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3458 GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3459 GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3460 GLAPI void APIENTRY glAttachShader (GLuint, GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3461 GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3462 GLAPI void APIENTRY glCompileShader (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3463 GLAPI GLuint APIENTRY glCreateProgram (void);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3464 GLAPI GLuint APIENTRY glCreateShader (GLenum);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3465 GLAPI void APIENTRY glDeleteProgram (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3466 GLAPI void APIENTRY glDeleteShader (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3467 GLAPI void APIENTRY glDetachShader (GLuint, GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3468 GLAPI void APIENTRY glDisableVertexAttribArray (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3469 GLAPI void APIENTRY glEnableVertexAttribArray (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3470 GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3471 GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3472 GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3473 GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3474 GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3475 GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3476 GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3477 GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3478 GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3479 GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3480 GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3481 GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3482 GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3483 GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3484 GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3485 GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3486 GLAPI GLboolean APIENTRY glIsProgram (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3487 GLAPI GLboolean APIENTRY glIsShader (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3488 GLAPI void APIENTRY glLinkProgram (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3489 GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3490 GLAPI void APIENTRY glUseProgram (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3491 GLAPI void APIENTRY glUniform1f (GLint, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3492 GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3493 GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3494 GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3495 GLAPI void APIENTRY glUniform1i (GLint, GLint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3496 GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3497 GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3498 GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3499 GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3500 GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3501 GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3502 GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3503 GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3504 GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3505 GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3506 GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3507 GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3508 GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3509 GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3510 GLAPI void APIENTRY glValidateProgram (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3511 GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3512 GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3513 GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3514 GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3515 GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3516 GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3517 GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3518 GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3519 GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3520 GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3521 GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3522 GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3523 GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3524 GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3525 GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3526 GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3527 GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3528 GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3529 GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3530 GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3531 GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3532 GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3533 GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3534 GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3535 GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3536 GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3537 GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3538 GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3539 GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3540 GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3541 GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3542 GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3543 GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3544 GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3545 GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3546 GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3547 GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3548 #endif /* GL_GLEXT_PROTOTYPES */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3549 typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3550 typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3551 typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3552 typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3553 typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3554 typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3555 typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3556 typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3557 typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3558 typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3559 typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3560 typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3561 typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3562 typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3563 typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3564 typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3565 typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3566 typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3567 typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3568 typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3569 typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3570 typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3571 typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3572 typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3573 typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3574 typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3575 typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3576 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3577 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3578 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3579 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3580 typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3581 typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3582 typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3583 typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3584 typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3585 typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3586 typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3587 typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3588 typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3589 typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3590 typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3591 typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3592 typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3593 typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3594 typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3595 typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3596 typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3597 typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3598 typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3599 typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3600 typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3601 typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3602 typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3603 typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3604 typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3605 typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3606 typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3607 typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3608 typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3609 typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3610 typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3611 typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3612 typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3613 typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3614 typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3615 typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3616 typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3617 typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3618 typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3619 typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3620 typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3621 typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3622 typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3623 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3624 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3625 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3626 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3627 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3628 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3629 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3630 typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3631 typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3632 typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3633 typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3634 typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3635 typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3636 typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3637 typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3638 typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3639 typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3640 typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3641 typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3642 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3643
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3644 #ifndef GL_ARB_multitexture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3645 #define GL_ARB_multitexture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3646 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3647 GLAPI void APIENTRY glActiveTextureARB (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3648 GLAPI void APIENTRY glClientActiveTextureARB (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3649 GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3650 GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3651 GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3652 GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3653 GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3654 GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3655 GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3656 GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3657 GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3658 GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3659 GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3660 GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3661 GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3662 GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3663 GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3664 GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3665 GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3666 GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3667 GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3668 GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3669 GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3670 GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3671 GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3672 GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3673 GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3674 GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3675 GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3676 GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3677 GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3678 GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3679 GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3680 GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3681 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3682 typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3683 typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3684 typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3685 typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3686 typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3687 typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3688 typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3689 typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3690 typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3691 typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3692 typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3693 typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3694 typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3695 typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3696 typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3697 typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3698 typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3699 typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3700 typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3701 typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3702 typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3703 typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3704 typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3705 typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3706 typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3707 typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3708 typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3709 typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3710 typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3711 typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3712 typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3713 typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3714 typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3715 typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3716 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3717
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3718 #ifndef GL_ARB_transpose_matrix
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3719 #define GL_ARB_transpose_matrix 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3720 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3721 GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3722 GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3723 GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3724 GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3725 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3726 typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3727 typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3728 typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3729 typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3730 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3731
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3732 #ifndef GL_ARB_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3733 #define GL_ARB_multisample 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3734 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3735 GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3736 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3737 typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3738 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3739
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3740 #ifndef GL_ARB_texture_env_add
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3741 #define GL_ARB_texture_env_add 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3742 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3743
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3744 #ifndef GL_ARB_texture_cube_map
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3745 #define GL_ARB_texture_cube_map 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3746 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3747
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3748 #ifndef GL_ARB_texture_compression
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3749 #define GL_ARB_texture_compression 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3750 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3751 GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3752 GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3753 GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3754 GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3755 GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3756 GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3757 GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3758 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3759 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3760 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3761 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3762 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3763 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3764 typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3765 typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3766 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3767
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3768 #ifndef GL_ARB_texture_border_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3769 #define GL_ARB_texture_border_clamp 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3770 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3771
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3772 #ifndef GL_ARB_point_parameters
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3773 #define GL_ARB_point_parameters 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3774 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3775 GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3776 GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3777 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3778 typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3779 typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3780 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3781
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3782 #ifndef GL_ARB_vertex_blend
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3783 #define GL_ARB_vertex_blend 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3784 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3785 GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3786 GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3787 GLAPI void APIENTRY glWeightivARB (GLint, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3788 GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3789 GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3790 GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3791 GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3792 GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3793 GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3794 GLAPI void APIENTRY glVertexBlendARB (GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3795 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3796 typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3797 typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3798 typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3799 typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3800 typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3801 typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3802 typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3803 typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3804 typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3805 typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3806 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3807
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3808 #ifndef GL_ARB_matrix_palette
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3809 #define GL_ARB_matrix_palette 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3810 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3811 GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3812 GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3813 GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3814 GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3815 GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3816 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3817 typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3818 typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3819 typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3820 typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3821 typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3822 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3823
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3824 #ifndef GL_ARB_texture_env_combine
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3825 #define GL_ARB_texture_env_combine 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3826 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3827
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3828 #ifndef GL_ARB_texture_env_crossbar
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3829 #define GL_ARB_texture_env_crossbar 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3830 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3831
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3832 #ifndef GL_ARB_texture_env_dot3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3833 #define GL_ARB_texture_env_dot3 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3834 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3835
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3836 #ifndef GL_ARB_texture_mirrored_repeat
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
3837 #define GL_ARB_texture_mirrored_repeat 1
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3838 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3839
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3840 #ifndef GL_ARB_depth_texture
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3841 #define GL_ARB_depth_texture 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3842 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3844 #ifndef GL_ARB_shadow
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3845 #define GL_ARB_shadow 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3846 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3847
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3848 #ifndef GL_ARB_shadow_ambient
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3849 #define GL_ARB_shadow_ambient 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3850 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3851
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3852 #ifndef GL_ARB_window_pos
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3853 #define GL_ARB_window_pos 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3854 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3855 GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3856 GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3857 GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3858 GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3859 GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3860 GLAPI void APIENTRY glWindowPos2ivARB (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3861 GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3862 GLAPI void APIENTRY glWindowPos2svARB (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3863 GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3864 GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3865 GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3866 GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3867 GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3868 GLAPI void APIENTRY glWindowPos3ivARB (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3869 GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3870 GLAPI void APIENTRY glWindowPos3svARB (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3871 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3872 typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3873 typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3874 typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3875 typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3876 typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3877 typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3878 typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3879 typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3880 typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3881 typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3882 typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3883 typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3884 typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3885 typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3886 typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3887 typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3888 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3889
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3890 #ifndef GL_ARB_vertex_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3891 #define GL_ARB_vertex_program 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3892 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3893 GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3894 GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3895 GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3896 GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3897 GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3898 GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3899 GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3900 GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3901 GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3902 GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3903 GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3904 GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3905 GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3906 GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3907 GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3908 GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3909 GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3910 GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3911 GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3912 GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3913 GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3914 GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3915 GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3916 GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3917 GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3918 GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3919 GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3920 GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3921 GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3922 GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3923 GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3924 GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3925 GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3926 GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3927 GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3928 GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3929 GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3930 GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3931 GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3932 GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3933 GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3934 GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3935 GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3936 GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3937 GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3938 GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3939 GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3940 GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3941 GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3942 GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3943 GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3944 GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3945 GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3946 GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3947 GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3948 GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3949 GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3950 GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3951 GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3952 GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3953 GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3954 GLAPI GLboolean APIENTRY glIsProgramARB (GLuint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
3955 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3956 typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3957 typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3958 typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3959 typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3960 typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3961 typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3962 typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3963 typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3964 typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3965 typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3966 typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3967 typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3968 typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3969 typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3970 typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3971 typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3972 typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3973 typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3974 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3975 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3976 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3977 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3978 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3979 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3980 typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3981 typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3982 typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3983 typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3984 typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3985 typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3986 typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3987 typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3988 typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3989 typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3990 typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3991 typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3992 typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3993 typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3994 typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3995 typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3996 typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3997 typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3998 typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
3999 typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4000 typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4001 typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4002 typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4003 typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4004 typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4005 typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4006 typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4007 typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4008 typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4009 typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4010 typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4011 typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4012 typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4013 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4014 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4015 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4016 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4017 typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4018 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4019
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4020 #ifndef GL_ARB_fragment_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4021 #define GL_ARB_fragment_program 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4022 /* All ARB_fragment_program entry points are shared with ARB_vertex_program. */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4023 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4024
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4025 #ifndef GL_ARB_vertex_buffer_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4026 #define GL_ARB_vertex_buffer_object 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4027 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4028 GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4029 GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4030 GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4031 GLAPI GLboolean APIENTRY glIsBufferARB (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4032 GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4033 GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4034 GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4035 GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4036 GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4037 GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4038 GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4039 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4040 typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4041 typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4042 typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4043 typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4044 typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4045 typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4046 typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4047 typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4048 typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4049 typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4050 typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4051 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4052
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4053 #ifndef GL_ARB_occlusion_query
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4054 #define GL_ARB_occlusion_query 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4055 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4056 GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4057 GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4058 GLAPI GLboolean APIENTRY glIsQueryARB (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4059 GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4060 GLAPI void APIENTRY glEndQueryARB (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4061 GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4062 GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4063 GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4064 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4065 typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4066 typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4067 typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4068 typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4069 typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4070 typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4071 typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4072 typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4073 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4074
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4075 #ifndef GL_ARB_shader_objects
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4076 #define GL_ARB_shader_objects 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4077 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4078 GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4079 GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4080 GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4081 GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4082 GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4083 GLAPI void APIENTRY glCompileShaderARB (GLhandleARB);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4084 GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4085 GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4086 GLAPI void APIENTRY glLinkProgramARB (GLhandleARB);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4087 GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4088 GLAPI void APIENTRY glValidateProgramARB (GLhandleARB);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4089 GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4090 GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4091 GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4092 GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4093 GLAPI void APIENTRY glUniform1iARB (GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4094 GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4095 GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4096 GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4097 GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4098 GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4099 GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4100 GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4101 GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4102 GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4103 GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4104 GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4105 GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4106 GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4107 GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4108 GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4109 GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4110 GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4111 GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4112 GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4113 GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4114 GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4115 GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4116 GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4117 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4118 typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4119 typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4120 typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4121 typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4122 typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4123 typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4124 typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4125 typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4126 typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4127 typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4128 typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4129 typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4130 typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4131 typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4132 typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4133 typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4134 typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4135 typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4136 typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4137 typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4138 typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4139 typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4140 typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4141 typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4142 typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4143 typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4144 typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4145 typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4146 typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4147 typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4148 typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4149 typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4150 typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4151 typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4152 typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4153 typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4154 typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4155 typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4156 typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4157 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4158
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4159 #ifndef GL_ARB_vertex_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4160 #define GL_ARB_vertex_shader 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4161 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4162 GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4163 GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4164 GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4165 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4166 typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4167 typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4168 typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4169 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4170
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4171 #ifndef GL_ARB_fragment_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4172 #define GL_ARB_fragment_shader 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4173 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4174
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4175 #ifndef GL_ARB_shading_language_100
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4176 #define GL_ARB_shading_language_100 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4177 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4178
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4179 #ifndef GL_ARB_texture_non_power_of_two
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4180 #define GL_ARB_texture_non_power_of_two 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4181 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4182
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4183 #ifndef GL_ARB_point_sprite
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4184 #define GL_ARB_point_sprite 1
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4185 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4186
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4187 #ifndef GL_ARB_fragment_program_shadow
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4188 #define GL_ARB_fragment_program_shadow 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4189 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4190
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4191 #ifndef GL_ARB_draw_buffers
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4192 #define GL_ARB_draw_buffers 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4193 #ifdef GL_GLEXT_PROTOTYPES
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4194 GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4195 #endif /* GL_GLEXT_PROTOTYPES */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4196 typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4197 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4198
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4199 #ifndef GL_ARB_texture_rectangle
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4200 #define GL_ARB_texture_rectangle 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4201 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4202
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4203 #ifndef GL_ARB_color_buffer_float
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4204 #define GL_ARB_color_buffer_float 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4205 #ifdef GL_GLEXT_PROTOTYPES
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4206 GLAPI void APIENTRY glClampColorARB (GLenum, GLenum);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4207 #endif /* GL_GLEXT_PROTOTYPES */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4208 typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4209 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4210
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4211 #ifndef GL_ARB_half_float_pixel
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4212 #define GL_ARB_half_float_pixel 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4213 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4214
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4215 #ifndef GL_ARB_texture_float
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4216 #define GL_ARB_texture_float 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4217 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4218
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4219 #ifndef GL_ARB_pixel_buffer_object
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4220 #define GL_ARB_pixel_buffer_object 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4221 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
4222
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4223 #ifndef GL_EXT_abgr
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4224 #define GL_EXT_abgr 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4225 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4226
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4227 #ifndef GL_EXT_blend_color
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4228 #define GL_EXT_blend_color 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4229 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4230 GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4231 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4232 typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4233 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4234
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4235 #ifndef GL_EXT_polygon_offset
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4236 #define GL_EXT_polygon_offset 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4237 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4238 GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4239 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4240 typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4241 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4242
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4243 #ifndef GL_EXT_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4244 #define GL_EXT_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4245 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4246
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4247 #ifndef GL_EXT_texture3D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4248 #define GL_EXT_texture3D 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4249 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4250 GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4251 GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4252 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4253 typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4254 typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4255 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4256
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4257 #ifndef GL_SGIS_texture_filter4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4258 #define GL_SGIS_texture_filter4 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4259 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4260 GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4261 GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4262 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4263 typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4264 typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4265 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4266
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4267 #ifndef GL_EXT_subtexture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4268 #define GL_EXT_subtexture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4269 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4270 GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4271 GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4272 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4273 typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4274 typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4275 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4276
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4277 #ifndef GL_EXT_copy_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4278 #define GL_EXT_copy_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4279 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4280 GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4281 GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4282 GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4283 GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4284 GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4285 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4286 typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4287 typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4288 typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4289 typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4290 typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4291 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4292
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4293 #ifndef GL_EXT_histogram
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4294 #define GL_EXT_histogram 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4295 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4296 GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4297 GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4298 GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4299 GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4300 GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4301 GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4302 GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4303 GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4304 GLAPI void APIENTRY glResetHistogramEXT (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4305 GLAPI void APIENTRY glResetMinmaxEXT (GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4306 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4307 typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4308 typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4309 typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4310 typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4311 typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4312 typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4313 typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4314 typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4315 typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4316 typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4317 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4318
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4319 #ifndef GL_EXT_convolution
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4320 #define GL_EXT_convolution 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4321 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4322 GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4323 GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4324 GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4325 GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4326 GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4327 GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4328 GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4329 GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4330 GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4331 GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4332 GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4333 GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4334 GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4335 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4336 typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4337 typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4338 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4339 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4340 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4341 typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4342 typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4343 typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4344 typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4345 typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4346 typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4347 typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4348 typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4349 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4350
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4351 #ifndef GL_EXT_color_matrix
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4352 #define GL_EXT_color_matrix 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4353 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4354
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4355 #ifndef GL_SGI_color_table
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4356 #define GL_SGI_color_table 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4357 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4358 GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4359 GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4360 GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4361 GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4362 GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4363 GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4364 GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4365 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4366 typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4367 typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4368 typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4369 typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4370 typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4371 typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4372 typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4373 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4374
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4375 #ifndef GL_SGIX_pixel_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4376 #define GL_SGIX_pixel_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4377 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4378 GLAPI void APIENTRY glPixelTexGenSGIX (GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4379 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4380 typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4381 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4382
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4383 #ifndef GL_SGIS_pixel_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4384 #define GL_SGIS_pixel_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4385 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4386 GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4387 GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4388 GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4389 GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4390 GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4391 GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4392 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4393 typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4394 typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4395 typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4396 typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4397 typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4398 typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4399 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4400
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4401 #ifndef GL_SGIS_texture4D
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4402 #define GL_SGIS_texture4D 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4403 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4404 GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4405 GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4406 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4407 typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4408 typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4409 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4410
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4411 #ifndef GL_SGI_texture_color_table
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4412 #define GL_SGI_texture_color_table 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4413 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4414
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4415 #ifndef GL_EXT_cmyka
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4416 #define GL_EXT_cmyka 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4417 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4418
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4419 #ifndef GL_EXT_texture_object
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4420 #define GL_EXT_texture_object 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4421 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4422 GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4423 GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4424 GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4425 GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4426 GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4427 GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4428 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4429 typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4430 typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4431 typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4432 typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4433 typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4434 typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4435 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4436
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4437 #ifndef GL_SGIS_detail_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4438 #define GL_SGIS_detail_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4439 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4440 GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4441 GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4442 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4443 typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4444 typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4445 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4446
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4447 #ifndef GL_SGIS_sharpen_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4448 #define GL_SGIS_sharpen_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4449 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4450 GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4451 GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4452 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4453 typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4454 typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4455 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4456
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4457 #ifndef GL_EXT_packed_pixels
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4458 #define GL_EXT_packed_pixels 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4459 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4460
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4461 #ifndef GL_SGIS_texture_lod
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4462 #define GL_SGIS_texture_lod 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4463 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4464
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4465 #ifndef GL_SGIS_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4466 #define GL_SGIS_multisample 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4467 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4468 GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4469 GLAPI void APIENTRY glSamplePatternSGIS (GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4470 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4471 typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4472 typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4473 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
4474
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4475 #ifndef GL_EXT_rescale_normal
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4476 #define GL_EXT_rescale_normal 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4477 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4478
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4479 #ifndef GL_EXT_vertex_array
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4480 #define GL_EXT_vertex_array 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4481 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4482 GLAPI void APIENTRY glArrayElementEXT (GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4483 GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4484 GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4485 GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4486 GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4487 GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4488 GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4489 GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4490 GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4491 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4492 typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4493 typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4494 typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4495 typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4496 typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4497 typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4498 typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4499 typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4500 typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4501 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4502
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4503 #ifndef GL_EXT_misc_attribute
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4504 #define GL_EXT_misc_attribute 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4505 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4506
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4507 #ifndef GL_SGIS_generate_mipmap
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4508 #define GL_SGIS_generate_mipmap 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4509 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4510
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4511 #ifndef GL_SGIX_clipmap
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4512 #define GL_SGIX_clipmap 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4513 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4514
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4515 #ifndef GL_SGIX_shadow
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4516 #define GL_SGIX_shadow 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4517 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4518
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4519 #ifndef GL_SGIS_texture_edge_clamp
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4520 #define GL_SGIS_texture_edge_clamp 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4521 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4522
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4523 #ifndef GL_SGIS_texture_border_clamp
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4524 #define GL_SGIS_texture_border_clamp 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4525 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4526
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4527 #ifndef GL_EXT_blend_minmax
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4528 #define GL_EXT_blend_minmax 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4529 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4530 GLAPI void APIENTRY glBlendEquationEXT (GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4531 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4532 typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4533 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4534
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4535 #ifndef GL_EXT_blend_subtract
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4536 #define GL_EXT_blend_subtract 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4537 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4538
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4539 #ifndef GL_EXT_blend_logic_op
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4540 #define GL_EXT_blend_logic_op 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4541 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4542
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4543 #ifndef GL_SGIX_interlace
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4544 #define GL_SGIX_interlace 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4545 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4546
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4547 #ifndef GL_SGIX_pixel_tiles
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4548 #define GL_SGIX_pixel_tiles 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4549 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4550
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4551 #ifndef GL_SGIX_texture_select
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4552 #define GL_SGIX_texture_select 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4553 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4554
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4555 #ifndef GL_SGIX_sprite
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4556 #define GL_SGIX_sprite 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4557 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4558 GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4559 GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4560 GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4561 GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4562 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4563 typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4564 typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4565 typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4566 typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4567 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4568
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4569 #ifndef GL_SGIX_texture_multi_buffer
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4570 #define GL_SGIX_texture_multi_buffer 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4571 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4572
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4573 #ifndef GL_EXT_point_parameters
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4574 #define GL_EXT_point_parameters 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4575 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4576 GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4577 GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4578 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4579 typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4580 typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4581 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4582
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4583 #ifndef GL_SGIS_point_parameters
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4584 #define GL_SGIS_point_parameters 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4585 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4586 GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4587 GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4588 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4589 typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4590 typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4591 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4592
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4593 #ifndef GL_SGIX_instruments
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4594 #define GL_SGIX_instruments 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4595 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4596 GLAPI GLint APIENTRY glGetInstrumentsSGIX (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4597 GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4598 GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4599 GLAPI void APIENTRY glReadInstrumentsSGIX (GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4600 GLAPI void APIENTRY glStartInstrumentsSGIX (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4601 GLAPI void APIENTRY glStopInstrumentsSGIX (GLint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4602 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4603 typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4604 typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4605 typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4606 typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4607 typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4608 typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4609 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4610
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4611 #ifndef GL_SGIX_texture_scale_bias
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4612 #define GL_SGIX_texture_scale_bias 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4613 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4614
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4615 #ifndef GL_SGIX_framezoom
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4616 #define GL_SGIX_framezoom 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4617 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4618 GLAPI void APIENTRY glFrameZoomSGIX (GLint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4619 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4620 typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4621 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4622
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4623 #ifndef GL_SGIX_tag_sample_buffer
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4624 #define GL_SGIX_tag_sample_buffer 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4625 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4626 GLAPI void APIENTRY glTagSampleBufferSGIX (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4627 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4628 typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4629 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4630
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4631 #ifndef GL_SGIX_polynomial_ffd
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4632 #define GL_SGIX_polynomial_ffd 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4633 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4634 GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4635 GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4636 GLAPI void APIENTRY glDeformSGIX (GLbitfield);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4637 GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4638 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4639 typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4640 typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4641 typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4642 typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4643 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4644
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4645 #ifndef GL_SGIX_reference_plane
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4646 #define GL_SGIX_reference_plane 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4647 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4648 GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4649 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4650 typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4651 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4652
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4653 #ifndef GL_SGIX_flush_raster
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4654 #define GL_SGIX_flush_raster 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4655 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4656 GLAPI void APIENTRY glFlushRasterSGIX (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4657 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4658 typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4659 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4660
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4661 #ifndef GL_SGIX_depth_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4662 #define GL_SGIX_depth_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4663 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4664
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4665 #ifndef GL_SGIS_fog_function
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4666 #define GL_SGIS_fog_function 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4667 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4668 GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4669 GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4670 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4671 typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4672 typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4673 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4674
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4675 #ifndef GL_SGIX_fog_offset
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4676 #define GL_SGIX_fog_offset 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4677 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4678
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4679 #ifndef GL_HP_image_transform
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4680 #define GL_HP_image_transform 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4681 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4682 GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4683 GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4684 GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4685 GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4686 GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4687 GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4688 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4689 typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4690 typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4691 typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4692 typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4693 typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4694 typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4695 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4696
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4697 #ifndef GL_HP_convolution_border_modes
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4698 #define GL_HP_convolution_border_modes 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4699 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4700
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4701 #ifndef GL_SGIX_texture_add_env
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4702 #define GL_SGIX_texture_add_env 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4703 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4704
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4705 #ifndef GL_EXT_color_subtable
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4706 #define GL_EXT_color_subtable 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4707 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4708 GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4709 GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4710 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4711 typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4712 typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4713 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4714
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4715 #ifndef GL_PGI_vertex_hints
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4716 #define GL_PGI_vertex_hints 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4717 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4718
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4719 #ifndef GL_PGI_misc_hints
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4720 #define GL_PGI_misc_hints 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4721 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4722 GLAPI void APIENTRY glHintPGI (GLenum, GLint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4723 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4724 typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4725 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4726
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4727 #ifndef GL_EXT_paletted_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4728 #define GL_EXT_paletted_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4729 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4730 GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4731 GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4732 GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4733 GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4734 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4735 typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4736 typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4737 typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4738 typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4739 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4740
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4741 #ifndef GL_EXT_clip_volume_hint
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4742 #define GL_EXT_clip_volume_hint 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4743 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4744
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4745 #ifndef GL_SGIX_list_priority
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4746 #define GL_SGIX_list_priority 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4747 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4748 GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4749 GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4750 GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4751 GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4752 GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4753 GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4754 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4755 typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4756 typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4757 typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4758 typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4759 typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4760 typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4761 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4762
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4763 #ifndef GL_SGIX_ir_instrument1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4764 #define GL_SGIX_ir_instrument1 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4765 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4766
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4767 #ifndef GL_SGIX_calligraphic_fragment
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4768 #define GL_SGIX_calligraphic_fragment 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4769 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4770
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4771 #ifndef GL_SGIX_texture_lod_bias
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4772 #define GL_SGIX_texture_lod_bias 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4773 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4774
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4775 #ifndef GL_SGIX_shadow_ambient
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4776 #define GL_SGIX_shadow_ambient 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4777 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4778
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4779 #ifndef GL_EXT_index_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4780 #define GL_EXT_index_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4781 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4782
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4783 #ifndef GL_EXT_index_material
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4784 #define GL_EXT_index_material 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4785 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4786 GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4787 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4788 typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4789 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4790
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4791 #ifndef GL_EXT_index_func
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4792 #define GL_EXT_index_func 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4793 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4794 GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4795 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4796 typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4797 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4798
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4799 #ifndef GL_EXT_index_array_formats
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4800 #define GL_EXT_index_array_formats 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4801 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4802
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4803 #ifndef GL_EXT_compiled_vertex_array
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4804 #define GL_EXT_compiled_vertex_array 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4805 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4806 GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4807 GLAPI void APIENTRY glUnlockArraysEXT (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4808 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4809 typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4810 typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4811 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
4812
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4813 #ifndef GL_EXT_cull_vertex
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4814 #define GL_EXT_cull_vertex 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4815 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4816 GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4817 GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4818 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4819 typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4820 typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4821 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4822
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4823 #ifndef GL_SGIX_ycrcb
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4824 #define GL_SGIX_ycrcb 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4825 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4826
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4827 #ifndef GL_SGIX_fragment_lighting
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4828 #define GL_SGIX_fragment_lighting 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4829 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4830 GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4831 GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4832 GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4833 GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4834 GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4835 GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4836 GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4837 GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4838 GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4839 GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4840 GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4841 GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4842 GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4843 GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4844 GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4845 GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4846 GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4847 GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4848 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4849 typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4850 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4851 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4852 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4853 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4854 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4855 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4856 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4857 typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4858 typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4859 typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4860 typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4861 typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4862 typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4863 typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4864 typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4865 typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4866 typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4867 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4868
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4869 #ifndef GL_IBM_rasterpos_clip
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4870 #define GL_IBM_rasterpos_clip 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4871 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4872
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4873 #ifndef GL_HP_texture_lighting
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4874 #define GL_HP_texture_lighting 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4875 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4876
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4877 #ifndef GL_EXT_draw_range_elements
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4878 #define GL_EXT_draw_range_elements 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4879 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4880 GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4881 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4882 typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4883 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4884
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4885 #ifndef GL_WIN_phong_shading
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4886 #define GL_WIN_phong_shading 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4887 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4888
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4889 #ifndef GL_WIN_specular_fog
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4890 #define GL_WIN_specular_fog 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4891 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4892
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4893 #ifndef GL_EXT_light_texture
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4894 #define GL_EXT_light_texture 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4895 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4896 GLAPI void APIENTRY glApplyTextureEXT (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4897 GLAPI void APIENTRY glTextureLightEXT (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4898 GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4899 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4900 typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4901 typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4902 typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4903 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4904
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4905 #ifndef GL_SGIX_blend_alpha_minmax
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4906 #define GL_SGIX_blend_alpha_minmax 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4907 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4908
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4909 #ifndef GL_EXT_bgra
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4910 #define GL_EXT_bgra 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4911 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4912
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4913 #ifndef GL_SGIX_async
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4914 #define GL_SGIX_async 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4915 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4916 GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4917 GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4918 GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4919 GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4920 GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4921 GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4922 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4923 typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4924 typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4925 typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4926 typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4927 typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4928 typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4929 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4930
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4931 #ifndef GL_SGIX_async_pixel
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4932 #define GL_SGIX_async_pixel 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4933 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4934
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4935 #ifndef GL_SGIX_async_histogram
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4936 #define GL_SGIX_async_histogram 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4937 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4938
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4939 #ifndef GL_INTEL_parallel_arrays
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4940 #define GL_INTEL_parallel_arrays 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4941 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4942 GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4943 GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4944 GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4945 GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4946 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4947 typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4948 typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4949 typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4950 typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4951 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4952
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4953 #ifndef GL_HP_occlusion_test
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4954 #define GL_HP_occlusion_test 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4955 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4956
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4957 #ifndef GL_EXT_pixel_transform
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4958 #define GL_EXT_pixel_transform 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4959 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4960 GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4961 GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4962 GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4963 GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4964 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4965 typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4966 typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4967 typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4968 typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4969 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4970
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4971 #ifndef GL_EXT_pixel_transform_color_table
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4972 #define GL_EXT_pixel_transform_color_table 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4973 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4974
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4975 #ifndef GL_EXT_shared_texture_palette
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4976 #define GL_EXT_shared_texture_palette 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4977 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4978
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4979 #ifndef GL_EXT_separate_specular_color
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4980 #define GL_EXT_separate_specular_color 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4981 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4982
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4983 #ifndef GL_EXT_secondary_color
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4984 #define GL_EXT_secondary_color 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
4985 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4986 GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4987 GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4988 GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4989 GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4990 GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4991 GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4992 GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4993 GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4994 GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4995 GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4996 GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4997 GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4998 GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
4999 GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5000 GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5001 GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5002 GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5003 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5004 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5005 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5006 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5007 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5008 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5009 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5010 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5011 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5012 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5013 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5014 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5015 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5016 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5017 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5018 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5019 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5020 typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5021 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5022
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5023 #ifndef GL_EXT_texture_perturb_normal
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5024 #define GL_EXT_texture_perturb_normal 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5025 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5026 GLAPI void APIENTRY glTextureNormalEXT (GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5027 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5028 typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5029 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5030
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5031 #ifndef GL_EXT_multi_draw_arrays
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5032 #define GL_EXT_multi_draw_arrays 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5033 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5034 GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5035 GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5036 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5037 typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5038 typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5039 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5040
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5041 #ifndef GL_EXT_fog_coord
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5042 #define GL_EXT_fog_coord 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5043 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5044 GLAPI void APIENTRY glFogCoordfEXT (GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5045 GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5046 GLAPI void APIENTRY glFogCoorddEXT (GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5047 GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5048 GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5049 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5050 typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5051 typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5052 typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5053 typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5054 typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5055 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5056
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5057 #ifndef GL_REND_screen_coordinates
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5058 #define GL_REND_screen_coordinates 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5059 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5060
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5061 #ifndef GL_EXT_coordinate_frame
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5062 #define GL_EXT_coordinate_frame 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5063 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5064 GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5065 GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5066 GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5067 GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5068 GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5069 GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5070 GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5071 GLAPI void APIENTRY glTangent3ivEXT (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5072 GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5073 GLAPI void APIENTRY glTangent3svEXT (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5074 GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5075 GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5076 GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5077 GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5078 GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5079 GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5080 GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5081 GLAPI void APIENTRY glBinormal3ivEXT (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5082 GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5083 GLAPI void APIENTRY glBinormal3svEXT (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5084 GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5085 GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5086 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5087 typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5088 typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5089 typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5090 typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5091 typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5092 typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5093 typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5094 typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5095 typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5096 typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5097 typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5098 typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5099 typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5100 typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5101 typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5102 typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5103 typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5104 typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5105 typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5106 typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5107 typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5108 typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5109 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5110
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5111 #ifndef GL_EXT_texture_env_combine
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5112 #define GL_EXT_texture_env_combine 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5113 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5114
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5115 #ifndef GL_APPLE_specular_vector
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5116 #define GL_APPLE_specular_vector 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5117 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5118
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5119 #ifndef GL_APPLE_transform_hint
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5120 #define GL_APPLE_transform_hint 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5121 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5122
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5123 #ifndef GL_SGIX_fog_scale
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5124 #define GL_SGIX_fog_scale 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5125 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5126
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5127 #ifndef GL_SUNX_constant_data
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5128 #define GL_SUNX_constant_data 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5129 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5130 GLAPI void APIENTRY glFinishTextureSUNX (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5131 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5132 typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5133 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5134
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5135 #ifndef GL_SUN_global_alpha
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5136 #define GL_SUN_global_alpha 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5137 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5138 GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5139 GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5140 GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5141 GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5142 GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5143 GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5144 GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5145 GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5146 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5147 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5148 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5149 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5150 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5151 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5152 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5153 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5154 typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5155 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5156
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5157 #ifndef GL_SUN_triangle_list
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5158 #define GL_SUN_triangle_list 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5159 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5160 GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5161 GLAPI void APIENTRY glReplacementCodeusSUN (GLushort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5162 GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5163 GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5164 GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5165 GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5166 GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5167 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5168 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5169 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5170 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5171 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5172 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5173 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5174 typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5175 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
5176
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5177 #ifndef GL_SUN_vertex
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5178 #define GL_SUN_vertex 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5179 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5180 GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5181 GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5182 GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5183 GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5184 GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5185 GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5186 GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5187 GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5188 GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5189 GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5190 GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5191 GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5192 GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5193 GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5194 GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5195 GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5196 GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5197 GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5198 GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5199 GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5200 GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5201 GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5202 GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5203 GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5204 GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5205 GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5206 GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5207 GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5208 GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5209 GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5210 GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5211 GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5212 GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5213 GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5214 GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5215 GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5216 GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5217 GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5218 GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5219 GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5220 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5221 typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5222 typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5223 typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5224 typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5225 typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5226 typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5227 typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5228 typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5229 typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5230 typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5231 typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5232 typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5233 typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5234 typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5235 typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5236 typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5237 typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5238 typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5239 typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5240 typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5241 typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5242 typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5243 typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5244 typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5245 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5246 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5247 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5248 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5249 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5250 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5251 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5252 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5253 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5254 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5255 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5256 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5257 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5258 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5259 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5260 typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5261 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5262
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5263 #ifndef GL_EXT_blend_func_separate
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5264 #define GL_EXT_blend_func_separate 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5265 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5266 GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5267 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5268 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5269 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5270
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5271 #ifndef GL_INGR_blend_func_separate
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5272 #define GL_INGR_blend_func_separate 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5273 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5274 GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5275 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5276 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5277 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5278
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5279 #ifndef GL_INGR_color_clamp
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5280 #define GL_INGR_color_clamp 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5281 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5282
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5283 #ifndef GL_INGR_interlace_read
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5284 #define GL_INGR_interlace_read 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5285 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5286
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5287 #ifndef GL_EXT_stencil_wrap
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5288 #define GL_EXT_stencil_wrap 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5289 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5290
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5291 #ifndef GL_EXT_422_pixels
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5292 #define GL_EXT_422_pixels 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5293 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5294
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5295 #ifndef GL_NV_texgen_reflection
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5296 #define GL_NV_texgen_reflection 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5297 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5298
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5299 #ifndef GL_SUN_convolution_border_modes
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5300 #define GL_SUN_convolution_border_modes 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5301 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5302
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5303 #ifndef GL_EXT_texture_env_add
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5304 #define GL_EXT_texture_env_add 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5305 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5306
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5307 #ifndef GL_EXT_texture_lod_bias
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5308 #define GL_EXT_texture_lod_bias 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5309 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5310
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5311 #ifndef GL_EXT_texture_filter_anisotropic
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5312 #define GL_EXT_texture_filter_anisotropic 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5313 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5314
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5315 #ifndef GL_EXT_vertex_weighting
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5316 #define GL_EXT_vertex_weighting 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5317 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5318 GLAPI void APIENTRY glVertexWeightfEXT (GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5319 GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5320 GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5321 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5322 typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5323 typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5324 typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5325 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5326
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5327 #ifndef GL_NV_light_max_exponent
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5328 #define GL_NV_light_max_exponent 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5329 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5330
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5331 #ifndef GL_NV_vertex_array_range
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5332 #define GL_NV_vertex_array_range 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5333 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5334 GLAPI void APIENTRY glFlushVertexArrayRangeNV (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5335 GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5336 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5337 typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5338 typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5339 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
5340
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5341 #ifndef GL_NV_register_combiners
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5342 #define GL_NV_register_combiners 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5343 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5344 GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5345 GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5346 GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5347 GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5348 GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5349 GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5350 GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5351 GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5352 GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5353 GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5354 GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5355 GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5356 GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5357 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5358 typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5359 typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5360 typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5361 typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5362 typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5363 typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5364 typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5365 typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5366 typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5367 typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5368 typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5369 typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5370 typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5371 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5372
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5373 #ifndef GL_NV_fog_distance
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5374 #define GL_NV_fog_distance 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5375 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5376
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5377 #ifndef GL_NV_texgen_emboss
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5378 #define GL_NV_texgen_emboss 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5379 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5380
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5381 #ifndef GL_NV_blend_square
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5382 #define GL_NV_blend_square 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5383 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5384
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5385 #ifndef GL_NV_texture_env_combine4
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5386 #define GL_NV_texture_env_combine4 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5387 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5388
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5389 #ifndef GL_MESA_resize_buffers
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5390 #define GL_MESA_resize_buffers 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5391 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5392 GLAPI void APIENTRY glResizeBuffersMESA (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5393 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5394 typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5395 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5396
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5397 #ifndef GL_MESA_window_pos
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5398 #define GL_MESA_window_pos 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5399 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5400 GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5401 GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5402 GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5403 GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5404 GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5405 GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5406 GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5407 GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5408 GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5409 GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5410 GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5411 GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5412 GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5413 GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5414 GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5415 GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5416 GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5417 GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5418 GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5419 GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5420 GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5421 GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5422 GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5423 GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5424 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5425 typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5426 typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5427 typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5428 typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5429 typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5430 typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5431 typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5432 typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5433 typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5434 typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5435 typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5436 typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5437 typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5438 typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5439 typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5440 typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5441 typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5442 typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5443 typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5444 typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5445 typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5446 typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5447 typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5448 typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5449 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5450
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5451 #ifndef GL_IBM_cull_vertex
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5452 #define GL_IBM_cull_vertex 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5453 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5454
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5455 #ifndef GL_IBM_multimode_draw_arrays
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5456 #define GL_IBM_multimode_draw_arrays 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5457 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5458 GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5459 GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5460 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5461 typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5462 typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5463 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5464
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5465 #ifndef GL_IBM_vertex_array_lists
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5466 #define GL_IBM_vertex_array_lists 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5467 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5468 GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5469 GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5470 GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5471 GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5472 GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5473 GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5474 GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5475 GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5476 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5477 typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5478 typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5479 typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5480 typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5481 typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5482 typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5483 typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5484 typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5485 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5486
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5487 #ifndef GL_SGIX_subsample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5488 #define GL_SGIX_subsample 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5489 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5490
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5491 #ifndef GL_SGIX_ycrcba
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5492 #define GL_SGIX_ycrcba 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5493 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5494
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5495 #ifndef GL_SGIX_ycrcb_subsample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5496 #define GL_SGIX_ycrcb_subsample 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5497 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5498
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5499 #ifndef GL_SGIX_depth_pass_instrument
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5500 #define GL_SGIX_depth_pass_instrument 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5501 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5502
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5503 #ifndef GL_3DFX_texture_compression_FXT1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5504 #define GL_3DFX_texture_compression_FXT1 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5505 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5506
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5507 #ifndef GL_3DFX_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5508 #define GL_3DFX_multisample 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5509 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5510
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5511 #ifndef GL_3DFX_tbuffer
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5512 #define GL_3DFX_tbuffer 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5513 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5514 GLAPI void APIENTRY glTbufferMask3DFX (GLuint);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5515 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5516 typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5517 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5518
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5519 #ifndef GL_EXT_multisample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5520 #define GL_EXT_multisample 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5521 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5522 GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5523 GLAPI void APIENTRY glSamplePatternEXT (GLenum);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5524 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5525 typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5526 typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5527 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5528
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5529 #ifndef GL_SGIX_vertex_preclip
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5530 #define GL_SGIX_vertex_preclip 1
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5531 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5532
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5533 #ifndef GL_SGIX_convolution_accuracy
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5534 #define GL_SGIX_convolution_accuracy 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5535 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5536
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5537 #ifndef GL_SGIX_resample
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5538 #define GL_SGIX_resample 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5539 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5540
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5541 #ifndef GL_SGIS_point_line_texgen
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5542 #define GL_SGIS_point_line_texgen 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5543 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5544
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5545 #ifndef GL_SGIS_texture_color_mask
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5546 #define GL_SGIS_texture_color_mask 1
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5547 #ifdef GL_GLEXT_PROTOTYPES
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5548 GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5549 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5550 typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5551 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5552
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5553 #ifndef GL_SGIX_igloo_interface
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5554 #define GL_SGIX_igloo_interface 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5555 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5556 GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5557 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5558 typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5559 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5560
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5561 #ifndef GL_EXT_texture_env_dot3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5562 #define GL_EXT_texture_env_dot3 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5563 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5564
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5565 #ifndef GL_ATI_texture_mirror_once
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5566 #define GL_ATI_texture_mirror_once 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5567 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5568
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5569 #ifndef GL_NV_fence
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5570 #define GL_NV_fence 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5571 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5572 GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5573 GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5574 GLAPI GLboolean APIENTRY glIsFenceNV (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5575 GLAPI GLboolean APIENTRY glTestFenceNV (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5576 GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5577 GLAPI void APIENTRY glFinishFenceNV (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5578 GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5579 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5580 typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5581 typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5582 typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5583 typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5584 typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5585 typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5586 typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5587 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5588
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5589 #ifndef GL_NV_evaluators
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5590 #define GL_NV_evaluators 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5591 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5592 GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5593 GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5594 GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5595 GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5596 GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5597 GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5598 GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5599 GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5600 GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5601 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5602 typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5603 typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5604 typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5605 typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5606 typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5607 typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5608 typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5609 typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5610 typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5611 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5612
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5613 #ifndef GL_NV_packed_depth_stencil
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5614 #define GL_NV_packed_depth_stencil 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5615 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5616
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5617 #ifndef GL_NV_register_combiners2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5618 #define GL_NV_register_combiners2 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5619 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5620 GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5621 GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5622 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5623 typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5624 typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5625 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5626
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5627 #ifndef GL_NV_texture_compression_vtc
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5628 #define GL_NV_texture_compression_vtc 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5629 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5630
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5631 #ifndef GL_NV_texture_rectangle
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5632 #define GL_NV_texture_rectangle 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5633 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5634
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5635 #ifndef GL_NV_texture_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5636 #define GL_NV_texture_shader 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5637 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5638
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5639 #ifndef GL_NV_texture_shader2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5640 #define GL_NV_texture_shader2 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5641 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5642
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5643 #ifndef GL_NV_vertex_array_range2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5644 #define GL_NV_vertex_array_range2 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5645 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5646
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5647 #ifndef GL_NV_vertex_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5648 #define GL_NV_vertex_program 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5649 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5650 GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5651 GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5652 GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5653 GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5654 GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5655 GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5656 GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5657 GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5658 GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5659 GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5660 GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5661 GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5662 GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5663 GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5664 GLAPI GLboolean APIENTRY glIsProgramNV (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5665 GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5666 GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5667 GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5668 GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5669 GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5670 GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5671 GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5672 GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5673 GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5674 GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5675 GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5676 GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5677 GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5678 GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5679 GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5680 GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5681 GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5682 GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5683 GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5684 GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5685 GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5686 GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5687 GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5688 GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5689 GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5690 GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5691 GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5692 GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5693 GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5694 GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5695 GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5696 GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5697 GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5698 GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5699 GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5700 GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5701 GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5702 GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5703 GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5704 GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5705 GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5706 GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5707 GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5708 GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5709 GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5710 GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5711 GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5712 GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5713 GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5714 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5715 typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5716 typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5717 typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5718 typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5719 typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5720 typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5721 typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5722 typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5723 typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5724 typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5725 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5726 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5727 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5728 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5729 typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5730 typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5731 typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5732 typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5733 typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5734 typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5735 typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5736 typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5737 typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5738 typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5739 typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5740 typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5741 typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5742 typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5743 typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5744 typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5745 typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5746 typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5747 typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5748 typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5749 typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5750 typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5751 typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5752 typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5753 typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5754 typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5755 typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5756 typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5757 typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5758 typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5759 typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5760 typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5761 typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5762 typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5763 typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5764 typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5765 typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5766 typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5767 typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5768 typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5769 typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5770 typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5771 typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5772 typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5773 typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5774 typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5775 typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5776 typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5777 typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5778 typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5779 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5780
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5781 #ifndef GL_SGIX_texture_coordinate_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5782 #define GL_SGIX_texture_coordinate_clamp 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5783 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5784
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5785 #ifndef GL_SGIX_scalebias_hint
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5786 #define GL_SGIX_scalebias_hint 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5787 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5788
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5789 #ifndef GL_OML_interlace
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5790 #define GL_OML_interlace 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5791 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5792
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5793 #ifndef GL_OML_subsample
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5794 #define GL_OML_subsample 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5795 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5796
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5797 #ifndef GL_OML_resample
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5798 #define GL_OML_resample 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5799 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5800
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5801 #ifndef GL_NV_copy_depth_to_color
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5802 #define GL_NV_copy_depth_to_color 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5803 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5804
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5805 #ifndef GL_ATI_envmap_bumpmap
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5806 #define GL_ATI_envmap_bumpmap 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5807 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5808 GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5809 GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5810 GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5811 GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5812 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5813 typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5814 typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5815 typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5816 typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5817 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5818
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5819 #ifndef GL_ATI_fragment_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5820 #define GL_ATI_fragment_shader 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5821 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5822 GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5823 GLAPI void APIENTRY glBindFragmentShaderATI (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5824 GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5825 GLAPI void APIENTRY glBeginFragmentShaderATI (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5826 GLAPI void APIENTRY glEndFragmentShaderATI (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5827 GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5828 GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5829 GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5830 GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5831 GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5832 GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5833 GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5834 GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5835 GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5836 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5837 typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5838 typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5839 typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5840 typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5841 typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5842 typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5843 typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5844 typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5845 typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5846 typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5847 typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5848 typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5849 typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5850 typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5851 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5852
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5853 #ifndef GL_ATI_pn_triangles
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5854 #define GL_ATI_pn_triangles 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5855 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5856 GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5857 GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5858 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5859 typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5860 typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5861 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5862
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5863 #ifndef GL_ATI_vertex_array_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5864 #define GL_ATI_vertex_array_object 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5865 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5866 GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5867 GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5868 GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5869 GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5870 GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5871 GLAPI void APIENTRY glFreeObjectBufferATI (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5872 GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5873 GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5874 GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5875 GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5876 GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5877 GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5878 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5879 typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5880 typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5881 typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5882 typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5883 typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5884 typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5885 typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5886 typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5887 typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5888 typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5889 typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5890 typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5891 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5892
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5893 #ifndef GL_EXT_vertex_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5894 #define GL_EXT_vertex_shader 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5895 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5896 GLAPI void APIENTRY glBeginVertexShaderEXT (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5897 GLAPI void APIENTRY glEndVertexShaderEXT (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5898 GLAPI void APIENTRY glBindVertexShaderEXT (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5899 GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5900 GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5901 GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5902 GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5903 GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5904 GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5905 GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5906 GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5907 GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5908 GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5909 GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5910 GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5911 GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5912 GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5913 GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5914 GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5915 GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5916 GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5917 GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5918 GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5919 GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5920 GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5921 GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5922 GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5923 GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5924 GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5925 GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5926 GLAPI GLuint APIENTRY glBindParameterEXT (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5927 GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5928 GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5929 GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5930 GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5931 GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5932 GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5933 GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5934 GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5935 GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5936 GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5937 GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *);
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
5938 #endif /* GL_GLEXT_PROTOTYPES */
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5939 typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5940 typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5941 typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5942 typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5943 typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5944 typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5945 typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5946 typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5947 typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5948 typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5949 typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5950 typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5951 typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5952 typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5953 typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5954 typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5955 typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5956 typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5957 typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5958 typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5959 typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5960 typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5961 typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5962 typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5963 typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5964 typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5965 typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5966 typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5967 typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5968 typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5969 typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5970 typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5971 typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5972 typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5973 typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5974 typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5975 typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5976 typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5977 typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5978 typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5979 typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5980 typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5981 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5982
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5983 #ifndef GL_ATI_vertex_streams
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5984 #define GL_ATI_vertex_streams 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5985 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5986 GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5987 GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5988 GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5989 GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5990 GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5991 GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5992 GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5993 GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5994 GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5995 GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5996 GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5997 GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5998 GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
5999 GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6000 GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6001 GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6002 GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6003 GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6004 GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6005 GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6006 GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6007 GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6008 GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6009 GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6010 GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6011 GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6012 GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6013 GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6014 GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6015 GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6016 GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6017 GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6018 GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6019 GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6020 GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6021 GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6022 GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6023 GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6024 GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6025 GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6026 GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6027 GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6028 GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6029 GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6030 GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6031 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6032 typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6033 typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6034 typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6035 typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6036 typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6037 typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6038 typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6039 typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6040 typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6041 typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6042 typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6043 typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6044 typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6045 typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6046 typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6047 typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6048 typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6049 typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6050 typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6051 typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6052 typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6053 typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6054 typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6055 typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6056 typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6057 typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6058 typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6059 typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6060 typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6061 typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6062 typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6063 typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6064 typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6065 typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6066 typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6067 typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6068 typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6069 typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6070 typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6071 typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6072 typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6073 typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6074 typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6075 typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6076 typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6077 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6078
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6079 #ifndef GL_ATI_element_array
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6080 #define GL_ATI_element_array 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6081 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6082 GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6083 GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6084 GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6085 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6086 typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6087 typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6088 typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6089 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6090
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6091 #ifndef GL_SUN_mesh_array
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6092 #define GL_SUN_mesh_array 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6093 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6094 GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6095 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6096 typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6097 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6098
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6099 #ifndef GL_SUN_slice_accum
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6100 #define GL_SUN_slice_accum 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6101 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6102
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6103 #ifndef GL_NV_multisample_filter_hint
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6104 #define GL_NV_multisample_filter_hint 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6105 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6106
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6107 #ifndef GL_NV_depth_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6108 #define GL_NV_depth_clamp 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6109 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6110
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6111 #ifndef GL_NV_occlusion_query
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6112 #define GL_NV_occlusion_query 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6113 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6114 GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6115 GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6116 GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6117 GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6118 GLAPI void APIENTRY glEndOcclusionQueryNV (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6119 GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6120 GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6121 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6122 typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6123 typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6124 typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6125 typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6126 typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6127 typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6128 typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6129 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6130
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6131 #ifndef GL_NV_point_sprite
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6132 #define GL_NV_point_sprite 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6133 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6134 GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6135 GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6136 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6137 typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6138 typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6139 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6140
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6141 #ifndef GL_NV_texture_shader3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6142 #define GL_NV_texture_shader3 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6143 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6144
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6145 #ifndef GL_NV_vertex_program1_1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6146 #define GL_NV_vertex_program1_1 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6147 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6148
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6149 #ifndef GL_EXT_shadow_funcs
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6150 #define GL_EXT_shadow_funcs 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6151 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6152
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6153 #ifndef GL_EXT_stencil_two_side
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6154 #define GL_EXT_stencil_two_side 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6155 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6156 GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6157 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6158 typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6159 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6160
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6161 #ifndef GL_ATI_text_fragment_shader
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6162 #define GL_ATI_text_fragment_shader 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6163 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6164
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6165 #ifndef GL_APPLE_client_storage
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6166 #define GL_APPLE_client_storage 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6167 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6168
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6169 #ifndef GL_APPLE_element_array
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6170 #define GL_APPLE_element_array 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6171 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6172 GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6173 GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6174 GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6175 GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6176 GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6177 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6178 typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6179 typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6180 typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6181 typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6182 typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6183 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6184
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6185 #ifndef GL_APPLE_fence
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6186 #define GL_APPLE_fence 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6187 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6188 GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6189 GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6190 GLAPI void APIENTRY glSetFenceAPPLE (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6191 GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6192 GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6193 GLAPI void APIENTRY glFinishFenceAPPLE (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6194 GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6195 GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6196 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6197 typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6198 typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6199 typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6200 typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6201 typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6202 typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6203 typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6204 typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6205 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6206
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6207 #ifndef GL_APPLE_vertex_array_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6208 #define GL_APPLE_vertex_array_object 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6209 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6210 GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6211 GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6212 GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, const GLuint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6213 GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6214 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6215 typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6216 typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6217 typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6218 typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6219 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6220
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6221 #ifndef GL_APPLE_vertex_array_range
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6222 #define GL_APPLE_vertex_array_range 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6223 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6224 GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6225 GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6226 GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6227 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6228 typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6229 typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6230 typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6231 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6232
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6233 #ifndef GL_APPLE_ycbcr_422
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6234 #define GL_APPLE_ycbcr_422 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6235 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6236
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6237 #ifndef GL_S3_s3tc
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6238 #define GL_S3_s3tc 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6239 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6240
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6241 #ifndef GL_ATI_draw_buffers
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6242 #define GL_ATI_draw_buffers 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6243 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6244 GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6245 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6246 typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6247 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6248
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6249 #ifndef GL_ATI_pixel_format_float
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6250 #define GL_ATI_pixel_format_float 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6251 /* This is really a WGL extension, but defines some associated GL enums.
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6252 * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string.
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6253 */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6254 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6255
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6256 #ifndef GL_ATI_texture_env_combine3
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6257 #define GL_ATI_texture_env_combine3 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6258 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6259
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6260 #ifndef GL_ATI_texture_float
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6261 #define GL_ATI_texture_float 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6262 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6263
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6264 #ifndef GL_NV_float_buffer
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6265 #define GL_NV_float_buffer 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6266 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6267
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6268 #ifndef GL_NV_fragment_program
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6269 #define GL_NV_fragment_program 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6270 /* Some NV_fragment_program entry points are shared with ARB_vertex_program. */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6271 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6272 GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6273 GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6274 GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6275 GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6276 GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6277 GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6278 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6279 typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6280 typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6281 typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6282 typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6283 typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6284 typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6285 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6286
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6287 #ifndef GL_NV_half_float
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6288 #define GL_NV_half_float 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6289 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6290 GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6291 GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6292 GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6293 GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6294 GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6295 GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6296 GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6297 GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6298 GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6299 GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6300 GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6301 GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6302 GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6303 GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6304 GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6305 GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6306 GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6307 GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6308 GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6309 GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6310 GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6311 GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6312 GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6313 GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6314 GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6315 GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6316 GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6317 GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6318 GLAPI void APIENTRY glFogCoordhNV (GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6319 GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6320 GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6321 GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6322 GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6323 GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6324 GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6325 GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6326 GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6327 GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6328 GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6329 GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6330 GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6331 GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6332 GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6333 GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6334 GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6335 GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6336 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6337 typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6338 typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6339 typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6340 typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6341 typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6342 typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6343 typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6344 typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6345 typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6346 typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6347 typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6348 typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6349 typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6350 typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6351 typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6352 typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6353 typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6354 typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6355 typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6356 typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6357 typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6358 typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6359 typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6360 typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6361 typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6362 typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6363 typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6364 typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6365 typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6366 typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6367 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6368 typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6369 typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6370 typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6371 typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6372 typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6373 typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6374 typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6375 typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6376 typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6377 typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6378 typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6379 typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6380 typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6381 typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6382 typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6383 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6384
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6385 #ifndef GL_NV_pixel_data_range
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6386 #define GL_NV_pixel_data_range 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6387 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6388 GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6389 GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6390 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6391 typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6392 typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6393 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6394
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6395 #ifndef GL_NV_primitive_restart
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6396 #define GL_NV_primitive_restart 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6397 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6398 GLAPI void APIENTRY glPrimitiveRestartNV (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6399 GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6400 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6401 typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6402 typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6403 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6404
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6405 #ifndef GL_NV_texture_expand_normal
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6406 #define GL_NV_texture_expand_normal 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6407 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6408
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6409 #ifndef GL_NV_vertex_program2
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6410 #define GL_NV_vertex_program2 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6411 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6412
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6413 #ifndef GL_ATI_map_object_buffer
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6414 #define GL_ATI_map_object_buffer 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6415 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6416 GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6417 GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6418 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6419 typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6420 typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6421 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6422
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6423 #ifndef GL_ATI_separate_stencil
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6424 #define GL_ATI_separate_stencil 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6425 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6426 GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6427 GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6428 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6429 typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6430 typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6431 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6432
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6433 #ifndef GL_ATI_vertex_attrib_array_object
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6434 #define GL_ATI_vertex_attrib_array_object 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6435 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6436 GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6437 GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6438 GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6439 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6440 typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6441 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6442 typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6443 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6444
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6445 #ifndef GL_OES_read_format
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6446 #define GL_OES_read_format 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6447 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6448
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6449 #ifndef GL_EXT_depth_bounds_test
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6450 #define GL_EXT_depth_bounds_test 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6451 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6452 GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6453 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6454 typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6455 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6456
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6457 #ifndef GL_EXT_texture_mirror_clamp
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6458 #define GL_EXT_texture_mirror_clamp 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6459 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6460
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6461 #ifndef GL_EXT_blend_equation_separate
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6462 #define GL_EXT_blend_equation_separate 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6463 #ifdef GL_GLEXT_PROTOTYPES
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6464 GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6465 #endif /* GL_GLEXT_PROTOTYPES */
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6466 typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha);
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6467 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6468
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6469 #ifndef GL_MESA_pack_invert
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6470 #define GL_MESA_pack_invert 1
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6471 #endif
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6472
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6473 #ifndef GL_MESA_ycbcr_texture
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6474 #define GL_MESA_ycbcr_texture 1
312
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
6475 #endif
d62b9aeaf0ea Used the glext.h from the SGI sample implementation
Sam Lantinga <slouken@libsdl.org>
parents: 297
diff changeset
6476
1205
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6477 #ifndef GL_EXT_pixel_buffer_object
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6478 #define GL_EXT_pixel_buffer_object 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6479 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6480
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6481 #ifndef GL_NV_fragment_program_option
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6482 #define GL_NV_fragment_program_option 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6483 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6484
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6485 #ifndef GL_NV_fragment_program2
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6486 #define GL_NV_fragment_program2 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6487 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6488
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6489 #ifndef GL_NV_vertex_program2_option
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6490 #define GL_NV_vertex_program2_option 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6491 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6492
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6493 #ifndef GL_NV_vertex_program3
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6494 #define GL_NV_vertex_program3 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6495 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6496
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6497 #ifndef GL_EXT_framebuffer_object
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6498 #define GL_EXT_framebuffer_object 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6499 #ifdef GL_GLEXT_PROTOTYPES
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6500 GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6501 GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6502 GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6503 GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6504 GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6505 GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6506 GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6507 GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6508 GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6509 GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6510 GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6511 GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6512 GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6513 GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6514 GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6515 GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6516 GLAPI void APIENTRY glGenerateMipmapEXT (GLenum);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6517 #endif /* GL_GLEXT_PROTOTYPES */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6518 typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6519 typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6520 typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6521 typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6522 typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6523 typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6524 typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6525 typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6526 typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6527 typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6528 typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6529 typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6530 typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6531 typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6532 typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6533 typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6534 typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6535 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6536
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6537 #ifndef GL_GREMEDY_string_marker
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6538 #define GL_GREMEDY_string_marker 1
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6539 #ifdef GL_GLEXT_PROTOTYPES
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6540 GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6541 #endif /* GL_GLEXT_PROTOTYPES */
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6542 typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string);
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6543 #endif
2ab21d9a20da Updated to the latest glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 932
diff changeset
6544
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
6545
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
6546 #ifdef __cplusplus
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
6547 }
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
6548 #endif
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
6549
843
748f441d7d9f Updated SDL_opengl.h to include the latest version of glext.h
Sam Lantinga <slouken@libsdl.org>
parents: 769
diff changeset
6550 #endif
214
0e5d6dd77bda Added platform independent OpenGL header - SDL_opengl.h
Sam Lantinga <slouken@libsdl.org>
parents:
diff changeset
6551 #endif /* NO_SDL_GLEXT */